KEGG   Magnetospirillum magneticum: amb0759Help
Entry
amb0759           CDS       T00305                                 

Definition
(GenBank) GGDEF domain
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mag  Magnetospirillum magneticum
Brite
Enzymes [BR:mag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     amb0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
816254..817312
Genome map
AA seq 352 aa AA seqDB search
MKSPDTLDVAAHCARAALAMMERHKVPPHPENYAIWYAYVAGRNPDLTAAIDAILQSGKK
FTAKVNDELYERFAVFPQDTAELREVGQRVEEAVGRVLEYLSNANQGTSNYGAALEDFSG
KLADGPSAAGLSELISGILAETKVMADLNRQLEQRLENSSNEVARLRNHLDDLKREASTD
ALTQLANRKLFDHSLNLAVLDARAADAPLSLLMIDIDHFKQFNDTYGHQLGDQVLKLVAR
SLSEVAQAKDTAARYGGEEFAVILPATPLEKSMEVAETIRNQVSTKRLTNRRTGQVLGQV
TLSIGAALLREAEAPDSLVHRADEAMYLAKRDGRNRVKSEIDLEKPTGEAAK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtccggatacccttgatgtcgccgcccattgcgcccgggcggcgctggccatg
atggagcggcacaaggtgccgccccatcccgagaattacgccatctggtacgcctatgtg
gccgggcgcaatccggacctgaccgccgccatcgacgccatcttgcaatcgggcaagaag
ttcacagccaaggtcaatgacgaactctacgagcgctttgccgtcttcccccaggacact
gccgaactgcgcgaagtgggccagcgggtcgaggaggcggtggggcgcgtgctggaatac
ctgagcaacgccaaccagggcaccagcaattacggcgcagccctggaggatttcagcggc
aagctggccgacgggccgtccgccgccgggttgtccgaactgatctcgggcatcctggcc
gagaccaaggtgatggccgatctgaaccggcaactggaacagcgcctggaaaactcgtcc
aacgaggtggcgcggctgcgcaaccacctggacgacctgaagcgcgaggcctccaccgac
gccctgacccagttggccaaccgcaagctgttcgatcactcgctcaatctggcggtgctc
gacgccagggcggcggatgcgccgctgtcgctgctgatgatcgacatcgatcacttcaag
cagttcaacgacacctacggccaccagctgggcgatcaggtgctgaagctggtggcgcgc
tcgctctccgaggtggcccaggccaaggataccgccgcccgctatggtggcgaggaattc
gcggtgatcctgcccgccacgcccctggagaagtccatggaggtggcggaaaccatccgc
aatcaggtctccaccaagcggctgaccaaccgtcgcactggtcaggtcctgggccaggtg
accctgtccatcggcgccgccctgcttcgggaggccgaggcccccgattccctggtccac
cgcgccgacgaggccatgtatctcgccaagcgcgacggccgcaaccgggtgaagagcgag
atcgacctggaaaagccaacgggcgaagcggcgaaatag

DBGET integrated database retrieval system