KEGG   Magnetospirillum magneticum: amb0759Help
Entry
amb0759           CDS       T00305                                 

Definition
GGDEF domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
mag  Magnetospirillum magneticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816254..817312
Genome map
AA seq 352 aa AA seqDB search
MKSPDTLDVAAHCARAALAMMERHKVPPHPENYAIWYAYVAGRNPDLTAAIDAILQSGKK
FTAKVNDELYERFAVFPQDTAELREVGQRVEEAVGRVLEYLSNANQGTSNYGAALEDFSG
KLADGPSAAGLSELISGILAETKVMADLNRQLEQRLENSSNEVARLRNHLDDLKREASTD
ALTQLANRKLFDHSLNLAVLDARAADAPLSLLMIDIDHFKQFNDTYGHQLGDQVLKLVAR
SLSEVAQAKDTAARYGGEEFAVILPATPLEKSMEVAETIRNQVSTKRLTNRRTGQVLGQV
TLSIGAALLREAEAPDSLVHRADEAMYLAKRDGRNRVKSEIDLEKPTGEAAK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtccggatacccttgatgtcgccgcccattgcgcccgggcggcgctggccatg
atggagcggcacaaggtgccgccccatcccgagaattacgccatctggtacgcctatgtg
gccgggcgcaatccggacctgaccgccgccatcgacgccatcttgcaatcgggcaagaag
ttcacagccaaggtcaatgacgaactctacgagcgctttgccgtcttcccccaggacact
gccgaactgcgcgaagtgggccagcgggtcgaggaggcggtggggcgcgtgctggaatac
ctgagcaacgccaaccagggcaccagcaattacggcgcagccctggaggatttcagcggc
aagctggccgacgggccgtccgccgccgggttgtccgaactgatctcgggcatcctggcc
gagaccaaggtgatggccgatctgaaccggcaactggaacagcgcctggaaaactcgtcc
aacgaggtggcgcggctgcgcaaccacctggacgacctgaagcgcgaggcctccaccgac
gccctgacccagttggccaaccgcaagctgttcgatcactcgctcaatctggcggtgctc
gacgccagggcggcggatgcgccgctgtcgctgctgatgatcgacatcgatcacttcaag
cagttcaacgacacctacggccaccagctgggcgatcaggtgctgaagctggtggcgcgc
tcgctctccgaggtggcccaggccaaggataccgccgcccgctatggtggcgaggaattc
gcggtgatcctgcccgccacgcccctggagaagtccatggaggtggcggaaaccatccgc
aatcaggtctccaccaagcggctgaccaaccgtcgcactggtcaggtcctgggccaggtg
accctgtccatcggcgccgccctgcttcgggaggccgaggcccccgattccctggtccac
cgcgccgacgaggccatgtatctcgccaagcgcgacggccgcaaccgggtgaagagcgag
atcgacctggaaaagccaacgggcgaagcggcgaaatag

DBGET integrated database retrieval system