KEGG   Magnetospirillum magneticum: amb1100Help
Entry
amb1100           CDS       T00305                                 

Definition
arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mag  Magnetospirillum magneticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    amb1100
Enzymes [BR:mag01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     amb1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1166159..1167052
Genome map
AA seq 297 aa AA seqDB search
MLPTFSLPPRFLGGCASDPGTATFCIAGIPFDLGVTNRSGAREGPQAVRRASRMLADGAN
PAGWSDPAQMSIADLGDFSLALGDIPRSLEMIEQQAAGIGHLLAVGGDHTITLALLRALV
KRTGPVGLVHFDAHIDTWPDNFGQKLAHGSPFFHALREGLVDPRRMIQIGIRSPMPREVY
DWTVGQGVTIVTAEQVHAQGPQWVAEAIGRVVGEGLTYLSFDIDAIDPGQAPGTGTPEVG
GLFTWQVMAILRRLAGLRFVGMDVVEVAPAYDVSEITALAAASILWQYLTLRPLDKL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctgccgacattttcccttcccccccgttttctgggcgggtgcgcgtcggacccgggc
accgcgacattctgcatcgccggcattcccttcgatcttggcgtgaccaaccgttcggga
gcccgcgaggggccgcaggcggtgcgccgcgccagccgcatgctggccgacggcgccaat
cccgccggctggagcgatccggcccaaatgtccatcgccgatctgggcgatttttccctg
gcgctgggcgacatccccaggtcgctggagatgatcgagcagcaggcggcgggcatcggc
cacctgctggccgtgggcggcgaccacaccatcaccctggccctgctgcgggccctggtc
aagcgcaccggcccggtggggctggtgcatttcgacgcccatatcgacacctggcccgat
aatttcggccagaagctggctcatggctcgccgttctttcatgccttgcgggaagggctg
gtggatccccggcgcatgatccagatcggcatccgctcgcccatgccgcgcgaggtgtac
gactggacggtggggcagggcgtcaccatcgtcaccgccgagcaggtccacgcccagggg
ccgcaatgggtggccgaagccatcggccgggtggtgggtgaggggctgacctatctcagc
ttcgacatcgacgccatcgatcccggccaggcgccgggcaccggcacgcccgaggtgggc
gggctgttcacctggcaggtgatggccatcctgcgccgtctggcgggactccgcttcgtc
ggcatggacgtggtcgaggtggcgccggcctatgacgtttccgagatcaccgccctggcg
gcggcctcgatcctgtggcagtacctgaccctgcggcccctggataaattgtaa

DBGET integrated database retrieval system