KEGG   Magnetospirillum magneticum: amb1364Help
Entry
amb1364           CDS       T00305                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mag  Magnetospirillum magneticum
Brite
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     amb1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479613..1480605
Genome map
AA seq 330 aa AA seqDB search
MAGPVLVTGATGFVGAAIVRALLARGEAVRVLARPASDRRNVANLHVEVAEGRLEDAASL
RKAMAGCRVLIHTAADYRIWVPDPAAMMKANVEGTRTLMEAALAEKVERVVYTSSVATLG
HVEGGVADEDTPSDISDKVGPYKQSKFLAEEVVRRMVAEQGLPAVICSPSTPIGPGDVKP
TPTGRMIVEAASGRMPAYVDTGLNIVHVDDVAAGHLLALDKGRIGERYILGGENLTLADI
LNRIAKITGGRPPLMKLPRWPLYPLALGAETWARFFGGEPFVTVDGLKMSRWHMFFSSAK
AERELGYRHRPADEALDAAVEWFKSIGEVP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctggacctgttctcgtcaccggggcgaccggatttgtcggtgccgccatcgtccgt
gccctgctggcgcggggcgaggccgtgcgcgtgctggcgcgccccgcttcggaccggcgc
aatgtcgccaatctgcatgtggaggtggccgagggccgcctggaagacgccgcctcgctg
cgcaaggccatggccggctgccgggtgctgatccacaccgccgcagactatcgcatctgg
gtgcccgatccggccgccatgatgaaggccaacgtcgagggcacgcggacgctgatggag
gccgccctggccgagaaggtggagcgcgtggtctacacctcgtcggtggcgacgctgggc
catgtggaaggcggcgtggccgacgaggacacccccagcgacatttccgacaaggtaggc
ccctacaagcagtccaagttcctggccgaggaagtggtgcgccgcatggtggccgaacag
ggcctgccggcggtgatctgcagcccctcgacccccatcggccccggcgacgtcaagccc
actcccaccgggcgcatgatcgtcgaggccgcctcgggccgcatgccggcctatgtggat
accggcctcaacatcgtccacgtggacgatgtggccgcgggccatctgctggccctggac
aagggccgcatcggcgagcgctacatcctgggcggcgagaatctgaccctggccgacatc
ctgaaccgcatcgccaagatcaccggcgggcgtccgccgctgatgaagctgccgcgctgg
ccgctctatccgctggccctgggcgccgagacctgggcccgcttcttcggcggcgagccc
ttcgtcaccgtggacgggctcaagatgtcgcgctggcacatgttcttctcctcggccaag
gccgagcgggaattggggtaccgccaccgtcccgccgacgaggcgctggacgcggcggtg
gagtggttcaagagcatcggggaggttccatga

DBGET integrated database retrieval system