KEGG   Magnetospirillum magneticum: amb1462Help
Entry
amb1462           CDS       T00305                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mag  Magnetospirillum magneticum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    amb1462
Enzymes [BR:mag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     amb1462
Peptidases [BR:mag01002]
 Cysteine Peptidases
  Family C44
   amb1462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592490..1594364
Genome map
AA seq 624 aa AA seqDB search
MGDFAGMWRLDGRPVDEADLTRMAQGLDGRNVAPARIWRSGPVALVHRRPARPFTPGEAR
ELQPLTGASGAVLVADSHPGALPILTALERRGVDGVLEGLCGSFAFAVWQPSERRLTLAR
DGAGFRTLFLHRSERLIAFSTRLRALLSLPDIPLDLDEHALAASLILDQSQPERTIYRAI
DRVPMGHVAVLTAQGTRVSRWWSLPRPGTLRHRNDSEVEEHARQVLDTVMDDALQAEGPV
TSCLTGGLDSSTIVTTALRRLGPRRLLAVTRVPDGPTPGDTACNYHDESPRASAMAALHP
GIDWYPISGDGGDWGESDARRWHLEGGQPTGASVNIAWFFPVYRFMEGQGSRVLLGGEQG
NGYFSYSGLSLLPELFLGLRWGRLAGHLLALARNEGRSAAYFFKREVLRPFEPLSWRMRR
LGRGPSPWSSHSALNPAFTREIRLDQSLDTGRYRQRVDGGHHSTFEARRWLLCDETARDV
RGVLRAMTGMDLRIPLADRRVLEFFGSLPLDQFLRNGVTRSLARRLLAGQVPAETVGNRT
AGTQNGDWFTRLSAARPAMIADLARLRSSPLARRVIDLDRIQGLLDHWPRDAAAAEPRRR
EYFHLLTRGLDMAGFLAWRESANN
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattttgccgggatgtggcgccttgacgggcggcctgtcgacgaggcggacctc
acccggatggcccagggattggacggccgcaatgtcgcgccggcccgtatctggcgatcg
gggccggtcgccctggtccaccgtcgcccggctcggccattcactccgggggaggcgcgg
gagcttcagccgctgaccggggcttccggcgcggttctggtcgccgacagccatcccggc
gccctgccgatcctcaccgccctggagcgccgtggggtcgacggtgtcctggaggggctt
tgtggatcgttcgccttcgccgtgtggcagccctccgagcgccgcctgacattggcccgt
gacggtgcgggatttcgtaccctgttcctgcatcgcagtgaacggctgatcgccttttcc
acccgtctgcgcgccctgctgtccctgcccgacattcccctggatctggacgagcatgcc
ctggcggccagcctgatcctcgaccagagccagccggaacgcaccatttaccgtgccatt
gatcgcgtccccatgggccatgtggcagtgctgaccgcgcaaggcacccgggtcagccgc
tggtggtcgcttccgcgccccggcaccctgcgccatcgcaacgattccgaggtcgaggag
catgcgcgccaagtgctcgacaccgtcatggacgacgcgctgcaggccgaggggccggtg
acgtcctgcctgaccggcgggctggacagttccaccatcgtcaccaccgccctgcgtcgc
cttgggccgaggcggctgctggccgtcacccgggtccccgatgggcccactcccggcgat
accgcctgcaactatcatgatgaatcgccccgggcgtcggccatggcggcgcttcaccct
ggtattgactggtatcccatctccggtgacggtggtgattggggcgagagcgatgccagg
agatggcacctggaaggggggcagccgaccggggcttcggtcaatatcgcttggttcttt
cccgtctaccgattcatggaggggcagggcagccgggtcctgctgggcggcgagcagggc
aacggctatttcagctattccgggctcagcctgttgccagagctgttcctggggttgcgg
tgggggcggctggccgggcatttgctggcgctggcccgcaacgaggggcgcagcgccgcc
tacttcttcaagcgggaagtgctgcggccgttcgagcccttgtcctggcggatgcgccgg
ctcgggcgggggccatccccctggagcagccattcagcgctcaacccggccttcacccgc
gagattcgcctggaccaaagcctggataccggccgttaccgccagcgggtggacgggggg
caccactcgaccttcgaggctcgccgctggctgctctgcgatgaaaccgcccgtgacgtg
cgcggcgtcctgcgcgccatgaccggcatggacctgcgtattcccctggccgatcgccgg
gttctggagtttttcggttccctgcccctggaccagttcctgagaaatggcgtcacccgg
tcactggcccgccgcctgttggccgggcaggtgccggccgagacggtgggaaaccgtacc
gccggcacccagaacggcgactggttcacccgtctcagcgccgcccgcccggcaatgatc
gccgacctggcccgcctgcgctcatcccccctggcccgccgcgtcatcgacctggatcgc
atccagggattgctggaccactggccgcgagacgcggcggcagccgagcccaggaggcgg
gagtatttccacctgctgacgcgtggcctggacatggccgggtttctcgcatggcgggaa
agtgccaataattga

DBGET integrated database retrieval system