KEGG   Magnetospirillum magneticum: amb1525Help
Entry
amb1525           CDS       T00305                                 

Definition
Phage-related lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mag  Magnetospirillum magneticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1656473..1656961
Genome map
AA seq 162 aa AA seqDB search
MASRIKTSVVIGMVATALISGAEGLRTQAYKDPVGIPTICFGETRGVKIGDTATREQCRA
MLDGRLVEISAAIDRCLVTAVPDMSYAALLSLAYNIGSGAFCASTLVKKANAGDVAGACE
EILRWDKAGGVALPGLTRRRGDEHDLCRQGLGGKPHSRGAGI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaggatcaaaacctcggttgtgatcggtatggtcgcgaccgccctgatttcc
ggggccgaggggctcaggacccaggcctataaagatccggtgggcatccccaccatctgc
ttcggcgagacgcggggcgtaaagatcggcgataccgccacccgcgagcagtgccgggcc
atgctcgacgggcgcctggtggagatcagtgccgcgatcgaccgctgtctcgttaccgcc
gtgcccgacatgagctacgccgccctcctgtcgctggcctacaatatcgggtcgggggcc
ttctgcgcctcgaccctggtcaaaaaggccaatgccggcgacgtcgccggcgcctgcgag
gagatcctccgctgggacaaggcggggggtgtcgcccttcctggcctgacccgccggcgc
ggggacgagcacgatctttgccgccagggcctggggggcaagccccattcgcggggggcg
ggaatatga

DBGET integrated database retrieval system