KEGG   Magnetospirillum magneticum: amb1531Help
Entry
amb1531           CDS       T00305                                 

Definition
(RefSeq) fructose-2,6-bisphosphatase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amb1531
   01230 Biosynthesis of amino acids
    amb1531
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amb1531
  Energy metabolism
   00680 Methane metabolism
    amb1531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amb1531
Enzymes [BR:mag01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     amb1531
Exosome [BR:mag04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   amb1531
  Exosomal proteins of melanoma cells
   amb1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1661856..1662440
Genome map
AA seq 194 aa AA seqDB search
MTVFLVRHGQSEGNRDLVFSGLSDHPLTELGRAQAAEAGWSLRGLNFAHVLTSRLSRAVA
TCDLLLAAAGSEVGRRRALEQLNERNFGVFEGVADDPATLAADPLRGRVASDVAYRPEGG
ESMLDCLERAVACFEGDILPLAADGHVLVVSHGNVVRSLALHHLGWPVEMLPEMPSRNCL
ITRIEPAGWVRSAR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcttcctggtccgtcacggccagtctgagggcaatcgcgatctggtgttctcg
ggactcagcgaccatccgctgaccgaactggggcgcgcccaggcggccgaggccgggtgg
tcgctgcgggggctgaacttcgcccacgttctgacctcgcgcctgtcgcgggcggtggcg
acctgtgacctgctgctggcggctgccggctcggaggtgggacgccgccgggccctggag
caactgaacgagcggaatttcggcgtgttcgagggcgttgccgacgatcctgcgacactg
gccgccgatccgcttcgcggccgggtcgcctcggacgtggcctatcgacccgagggtggg
gagtccatgctggactgcctggagagggccgtggcctgcttcgagggcgatattctgccc
ctggcggcggatggtcacgtgctggtggtgtcccacggcaacgtggtgcgctcgctggcg
ctgcaccatctgggctggccggtggagatgttgcccgaaatgccgtcgcgcaactgcctg
atcacccgcatcgaaccggcgggctgggtcagatccgctcgctga

DBGET integrated database retrieval system