KEGG   Magnetospirillum magneticum: amb1677Help
Entry
amb1677           CDS       T00305                                 

Definition
pyruvate with ferredoxin oxidoreductase and related 2-oxoacid with ferredoxin oxidoreductase
Orthology
K18358  
phenylglyoxylate dehydrogenase delta subunit [EC:1.2.1.58]
Organism
mag  Magnetospirillum magneticum
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    amb1677
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     amb1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1814748..1815017
Genome map
AA seq 89 aa AA seqDB search
MSLRNVPDNMCPIATEYTTMLTGDWRALRPIVDRDRCVKCATCWLYCPVQCVVEKAAWFD
FNYDYCKGCGICAEECPHRAIKMVEEAEG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccgcaatgttcccgacaacatgtgtcccatcgccaccgagtacaccaccatg
ctcaccggcgactggcgggcgctgcgtcccatcgtcgatcgcgaccgctgcgtcaaatgc
gccacctgctggctgtattgcccggtgcagtgcgtggtcgagaaggcggcgtggttcgac
ttcaactacgactattgcaagggctgcggcatctgcgccgaggaatgcccgcaccgcgcc
atcaagatggttgaagaggcggagggctga

DBGET integrated database retrieval system