KEGG   Magnetospirillum magneticum: amb1677Help
Entry
amb1677           CDS       T00305                                 

Definition
(GenBank) Pyruvate with ferredoxin oxidoreductase and related 2-oxoacid with ferredoxin oxidoreductase
  KO
K18358  phenylglyoxylate dehydrogenase delta subunit [EC:1.2.1.58]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00360  Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    amb1677
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     amb1677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_16 Fer4_7 Fer4_9 Fer4_10 Fer4_15 Fer4_13 Fer4_17 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: BAE50481
UniProt: Q2W6P4
Position
1814748..1815017
Genome map
AA seq 89 aa AA seqDB search
MSLRNVPDNMCPIATEYTTMLTGDWRALRPIVDRDRCVKCATCWLYCPVQCVVEKAAWFD
FNYDYCKGCGICAEECPHRAIKMVEEAEG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccgcaatgttcccgacaacatgtgtcccatcgccaccgagtacaccaccatg
ctcaccggcgactggcgggcgctgcgtcccatcgtcgatcgcgaccgctgcgtcaaatgc
gccacctgctggctgtattgcccggtgcagtgcgtggtcgagaaggcggcgtggttcgac
ttcaactacgactattgcaagggctgcggcatctgcgccgaggaatgcccgcaccgcgcc
atcaagatggttgaagaggcggagggctga

DBGET integrated database retrieval system