KEGG   Magnetospirillum magneticum: amb1678Help
Entry
amb1678           CDS       T00305                                 

Definition
NADH dependent phenylglyoxylate
Orthology
K18355  
phenylglyoxylate dehydrogenase alpha subunit [EC:1.2.1.58]
Organism
mag  Magnetospirillum magneticum
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    amb1678
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     amb1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815020..1816237
Genome map
AA seq 405 aa AA seqDB search
MNKVSTGKVIVCDGNEAAAWGACLSRPDMVAVYPITPQSSLVEYLAQFIADGRMDADLMD
VEGEHTVLSVLHGAVLAGARTYSATSAQGLAFMFEPYFRTPGLRLPMVVSLVTRDAVSPT
CVWGGQQDAMTVKEVGWIHMYCETQQEILDTIPIAYKVAEHPDVMLPVNVNHDGNYLSYG
VARVELPDQSVVDAFLGEKQVNWHACLDPERPMAVDPLTGGAGGIGPSLFVKYRKGICAG
MQDALRIIEEAHEDWGRRTGRYWSPLIEEYRMEDAEVALVTIGSMTGAAKDAVDDARASG
KKIGLVKIKTFRPFPAARIAQALSRVKAVGVVDRSVNFGWNCGPVYQEVLAAMYAQPVRI
PMMSFIGGLAGADITVEHFAEVVHRTFRLAGGEAATGPVWLNEND
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtttcgaccggcaaggtcatcgtctgcgacggtaacgaggcggcggcctgg
ggcgcctgcctgtcgcgtcccgacatggtggccgtctatcccatcacgccgcaaagctcg
ctggtggaatatctcgcccagtttatcgccgacggccgcatggacgccgacctgatggac
gtggagggcgagcacaccgtgctgtcggtgctgcacggcgccgtcctggccggggcgcgg
acctattccgccacctcggcccaggggctggccttcatgttcgagccctatttccgcacc
ccgggcctgcgcctgcccatggtggtgtcgctggtgacccgcgacgcggtgtcacccacc
tgcgtctggggcgggcagcaggacgccatgacggtgaaggaggtgggctggattcacatg
tactgcgagacccagcaggaaatcctcgacaccattcccatcgcctacaaggtggccgag
catcctgacgtgatgctgccggtcaacgtcaaccatgacggcaattacctgtcctatggc
gtggcgcgggtggagttgcccgaccagtcggtcgtcgatgccttcctgggcgagaagcag
gtcaactggcatgcctgtctcgacccggagcgccccatggcggtggacccgctgaccggc
ggggccggcggcatcggtccctcgctgttcgtcaagtatcgcaagggcatctgcgccggc
atgcaggacgcgctccggatcatcgaggaagcccacgaggattggggccggcgcaccgga
cgctactggtcgccgctgatcgaggaataccgcatggaggacgccgaagtggccctggtc
accatcggctccatgaccggcgccgccaaggatgcggtggatgacgcccgcgcttccggc
aagaagatcggtctggtcaagatcaagaccttccgtccgtttcccgccgcccgcatcgcc
caggcgctgtccagggtgaaggcggtcggtgtggtcgaccggtcggtcaacttcggctgg
aactgcggcccggtgtaccaggaagtcctggccgccatgtatgcccaaccggtccgtatc
cccatgatgagcttcatcggcggtctggccggggccgacatcaccgtcgagcacttcgcc
gaggtggtgcaccggaccttccgtctggccgggggcgaagccgccaccggtcccgtgtgg
ctgaacgagaacgattga

DBGET integrated database retrieval system