KEGG   Magnetospirillum magneticum: amb1787Help
Entry
amb1787           CDS       T00305                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    amb1787
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amb1787
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    amb1787
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     amb1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1924644..1926002
Genome map
AA seq 452 aa AA seqDB search
MTESTKYLLSEDRLPKAWYNLNADLPVPAPPPLHPGTGQPIGPDDLAPIFPMAVIAQEVT
AERWVEIPEPVREVYRLWRPAPLIRARRLEKALGTPARIYFKYEGVSPAGSHKPNTSVPQ
AFYNQQEGVKRLATETGAGQWGSSLAFAGSLFGLEVEVFMVKVSYEQKPYRRALMETYGA
KCIASPSNLTHAGRSILEKDPHSNGSLGIAISEAVEIAASRDDTKYALGSVLNHVCLHQT
IIGEEAMMQMEMADDHPDVVIACTGGGSNFAGLAFPYIRENLKGGKTRVIGVEPASCPTL
TKGLYAYDFGDTGKLTPLVKMHTLGATFMPPGSHAGGLRYHGMAPMVSHVKELGLMEARA
YHQTECFAAAVQFARAEGIVPAPESSHAVKGAIDEALRCKAEGKAETILFNLSGHGHFDM
QAYTDFFAGKLKDNTYAEADLQAALAELPNVG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccaagtacctgttgtccgaggatcgcctgcccaaggcctggtacaac
ctcaatgccgacctgccggtgcccgcgccgccgccgctgcatcccggcaccggccagccc
atcggtcccgacgatctggcgcccattttccccatggcggtgatcgcccaggaggtgacc
gccgagcgttgggtcgagatccccgagccggtgcgcgaggtctatcgcctgtggcgcccg
gcgccgctgatccgcgcccgccgcctggagaaggccttgggcacccctgccaggatctat
ttcaagtacgaaggcgtcagcccggccggcagccacaagcccaacacttcggtgccccag
gccttctataaccagcaggaaggggtcaagcgcctggccaccgagaccggcgccggccag
tggggctcgtcgctggccttcgccggctcgctgttcggcctggaggtcgaggtcttcatg
gtcaaggtctcctacgagcagaagccctatcgccgggccctgatggagacctatggcgcc
aaatgcatcgccagcccgtccaacctgacccatgcggggcgctccatcctggagaaggac
ccccattccaacggttcgctgggcatcgccatttccgaggcggtggagatcgccgcttcg
cgtgacgacaccaaatacgccctgggcagcgtgctcaaccacgtctgcctgcaccagacc
atcatcggcgaggaagccatgatgcagatggagatggccgacgatcacccggacgtggtc
atcgcctgcaccggcggcggctccaatttcgccggtctggccttcccctacatccgcgag
aacctcaagggtggcaagacccgggtcatcggtgtcgagcccgcctcgtgcccgaccctg
accaagggcctctacgcctatgatttcggcgatacgggtaagctgaccccgctggtcaag
atgcataccctgggcgccaccttcatgccgccgggctcgcacgccggcggcctgcgctat
cacggcatggcgccaatggtcagccacgtcaaggagctgggcctgatggaggcccgcgcc
tatcaccagaccgagtgcttcgcggcggccgtgcagtttgcccgtgccgagggcatcgtc
cctgcgccggaatcctcccacgccgtcaagggcgccatcgacgaggcgctccgctgcaag
gccgagggcaaggccgagaccatcctgttcaacctgtcgggccacggccatttcgacatg
caggcctataccgacttcttcgccggcaagctgaaggacaacacctacgccgaggccgac
ctgcaggcggccctggcggaattgcccaacgtggggtga

DBGET integrated database retrieval system