KEGG   Magnetospirillum magneticum: amb1787Help
Entry
amb1787           CDS       T00305                                 

Definition
(GenBank) Tryptophan synthase beta chain 2
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00260  Glycine, serine and threonine metabolism
mag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01130  Biosynthesis of antibiotics
mag01230  Biosynthesis of amino acids
Module
mag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amb1787
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    amb1787
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     amb1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAE50591
UniProt: Q2W6D4
Position
1924419..1926002
Genome map
AA seq 527 aa AA seqDB search
MDQLIKSQLLYQLSYTPSVSPVSAAAPAGGPLYRSNAGPVQAENSLHRALFAMTPSERKT
IPAISHPARGRGNAAMTESTKYLLSEDRLPKAWYNLNADLPVPAPPPLHPGTGQPIGPDD
LAPIFPMAVIAQEVTAERWVEIPEPVREVYRLWRPAPLIRARRLEKALGTPARIYFKYEG
VSPAGSHKPNTSVPQAFYNQQEGVKRLATETGAGQWGSSLAFAGSLFGLEVEVFMVKVSY
EQKPYRRALMETYGAKCIASPSNLTHAGRSILEKDPHSNGSLGIAISEAVEIAASRDDTK
YALGSVLNHVCLHQTIIGEEAMMQMEMADDHPDVVIACTGGGSNFAGLAFPYIRENLKGG
KTRVIGVEPASCPTLTKGLYAYDFGDTGKLTPLVKMHTLGATFMPPGSHAGGLRYHGMAP
MVSHVKELGLMEARAYHQTECFAAAVQFARAEGIVPAPESSHAVKGAIDEALRCKAEGKA
ETILFNLSGHGHFDMQAYTDFFAGKLKDNTYAEADLQAALAELPNVG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
ttggaccagctgattaagagtcagctgctctaccaactgagctatacgccctcagtgtct
ccggtttcggccgcagcccccgccggagggccgctttataggtcgaacgccgggcctgtg
caagcggaaaattcacttcaccgcgcactctttgcaatgacgccttcagagcgtaaaacc
atccccgcaatatcacatcccgcaagggggagagggaacgccgccatgaccgagagcacc
aagtacctgttgtccgaggatcgcctgcccaaggcctggtacaacctcaatgccgacctg
ccggtgcccgcgccgccgccgctgcatcccggcaccggccagcccatcggtcccgacgat
ctggcgcccattttccccatggcggtgatcgcccaggaggtgaccgccgagcgttgggtc
gagatccccgagccggtgcgcgaggtctatcgcctgtggcgcccggcgccgctgatccgc
gcccgccgcctggagaaggccttgggcacccctgccaggatctatttcaagtacgaaggc
gtcagcccggccggcagccacaagcccaacacttcggtgccccaggccttctataaccag
caggaaggggtcaagcgcctggccaccgagaccggcgccggccagtggggctcgtcgctg
gccttcgccggctcgctgttcggcctggaggtcgaggtcttcatggtcaaggtctcctac
gagcagaagccctatcgccgggccctgatggagacctatggcgccaaatgcatcgccagc
ccgtccaacctgacccatgcggggcgctccatcctggagaaggacccccattccaacggt
tcgctgggcatcgccatttccgaggcggtggagatcgccgcttcgcgtgacgacaccaaa
tacgccctgggcagcgtgctcaaccacgtctgcctgcaccagaccatcatcggcgaggaa
gccatgatgcagatggagatggccgacgatcacccggacgtggtcatcgcctgcaccggc
ggcggctccaatttcgccggtctggccttcccctacatccgcgagaacctcaagggtggc
aagacccgggtcatcggtgtcgagcccgcctcgtgcccgaccctgaccaagggcctctac
gcctatgatttcggcgatacgggtaagctgaccccgctggtcaagatgcataccctgggc
gccaccttcatgccgccgggctcgcacgccggcggcctgcgctatcacggcatggcgcca
atggtcagccacgtcaaggagctgggcctgatggaggcccgcgcctatcaccagaccgag
tgcttcgcggcggccgtgcagtttgcccgtgccgagggcatcgtccctgcgccggaatcc
tcccacgccgtcaagggcgccatcgacgaggcgctccgctgcaaggccgagggcaaggcc
gagaccatcctgttcaacctgtcgggccacggccatttcgacatgcaggcctataccgac
ttcttcgccggcaagctgaaggacaacacctacgccgaggccgacctgcaggcggccctg
gcggaattgcccaacgtggggtga

DBGET integrated database retrieval system