KEGG   Magnetospirillum magneticum: amb1819Help
Entry
amb1819           CDS       T00305                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amb1819
   01230 Biosynthesis of amino acids
    amb1819
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amb1819
   00051 Fructose and mannose metabolism
    amb1819
   00562 Inositol phosphate metabolism
    amb1819
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    amb1819
Enzymes [BR:mag01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     amb1819
Exosome [BR:mag04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   amb1819
  Exosomal proteins of bladder cancer cells
   amb1819
  Exosomal proteins of melanoma cells
   amb1819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959119..1959874
Genome map
AA seq 251 aa AA seqDB search
MTIRRKLIAGNWKMNGLKADGLALAKGLADKLASASPNCDMLVCPPFTLIAPVADALAGS
KLAVGGQDCHAKTSGAHTGDTSPAMLADLGCKYAIVGHSERRTDHAETDNVVKAKAAAAL
SAGLVAIVCIGETLAQRDAGQTIEVNRSQLNGSLPEGANAANTVIAYEPVWAIGTGRVAT
PAQAQEVHAAIRAELARLVGAEEAGKMRILYGGSMKPDNAKELLALPDVDGGLIGGAALK
VADFWAIAESC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcgacgcaagctgatcgccggaaactggaagatgaacgggctgaaggccgat
ggtctggcgctggccaagggcctcgccgacaagctggcgtccgcttctcccaattgcgac
atgctggtctgtccgcccttcaccctgatcgcgccggtggccgatgccctggccgggtcc
aagctggccgtcggcggccaggattgccatgccaagacctcgggtgcccataccggcgat
acctcgcccgccatgctggccgatctgggctgcaaatacgccatcgtcggccattccgag
cgccgcaccgaccacgccgagaccgataacgtggtcaaggccaaggccgccgccgctctc
agcgccggtctggtcgccatcgtctgcatcggcgagaccctggcccagcgcgacgccggc
cagaccatcgaggtcaaccgctcgcagttgaacggctcgctgcccgagggcgccaacgcc
gccaacaccgtcatcgcctacgagccggtctgggccatcggcaccggccgtgtcgccacg
cccgcccaggcgcaggaagtccacgccgccatccgtgccgaactcgcccggctggtgggc
gccgaagaggcgggcaagatgcgcatcctctacggcggctccatgaagcccgacaacgcc
aaggaattgctggccctgcccgacgtggacggcggcctgatcggtggcgcggcgctcaag
gtggcggatttctgggccatcgccgaaagctgctga

DBGET integrated database retrieval system