KEGG   Magnetospirillum magneticum: amb2112Help
Entry
amb2112           CDS       T00305                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00010  Glycolysis / Gluconeogenesis
mag00052  Galactose metabolism
mag00500  Starch and sucrose metabolism
mag00520  Amino sugar and nucleotide sugar metabolism
mag00521  Streptomycin biosynthesis
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01200  Carbon metabolism
Module
mag_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amb2112
   00052 Galactose metabolism
    amb2112
   00500 Starch and sucrose metabolism
    amb2112
   00520 Amino sugar and nucleotide sugar metabolism
    amb2112
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    amb2112
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    amb2112
Enzymes [BR:mag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     amb2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF4705
Motif
Other DBs
NCBI-ProteinID: BAE50916
UniProt: Q2W5F9
Position
2286735..2287700
Genome map
AA seq 321 aa AA seqDB search
MSQMVLVADIGGTHARFALMGPDGEAVNPVVLRCADYDGPAPAIKAYLAEHAGGVAPKGG
AFAVASVIDGDRIELTNSPWRFSIAETRQAVGLQRLEVVNDFTAVALSVRHLKPEHLMSV
GGGMPEAGLPIAVLGPGTGLGVSALIPSASGEWTALATEGGHVTMAAATEREARILDRLR
TQFDHVSAERVLSGQGLVNLYQAVAALSGHQAVFSTPDVITKRGLDGSCPVSREAVEVFF
AMMGTVAGNLALSLGAKGGVFIAGGILPRMAEAFRLSSFRTRFEAHGRFQPYLAAIPTWL
ITHPLPAFVGLAGLVTDPKNA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatggtgcttgtcgccgatatcggcggcacccatgcccgtttcgccctgatg
gggccggacggcgaggcggtcaacccggtggtgctgcgctgtgccgattacgacggtccg
gctccagccatcaaggcctacctcgccgagcatgccggcggcgtggcgcccaaaggcggc
gccttcgccgtggcctcggtgatcgacggcgaccgcatcgagctgaccaattccccctgg
cgcttctccatcgccgagacccggcaggcggttggtcttcagcgtctggaggtggtcaac
gacttcaccgccgtggccctgtcggtccgtcatctgaagcccgagcacctgatgtccgtc
ggtggaggaatgcccgaggcggggctgcccatcgccgtgctggggccggggaccggcctg
ggggtttcggccctgattccgtcggcttcgggggaatggacggccctggccaccgagggc
ggccacgtcaccatggccgccgccaccgagcgcgaggcccgtattctcgaccgcctgcgg
actcagttcgaccacgtctcggccgagcgggtgctgtcgggccaggggctggtcaacctc
tatcaggcggtggcggccctgtccggacatcaggcggtgttctccacccccgacgtcatc
accaagcgggggctggacggctcgtgccccgtcagccgcgaggcggtggaggtcttcttc
gccatgatgggcaccgtggcgggcaatctggcgctgtcgctgggggccaagggtggcgta
ttcatcgccggcggcatcctgccgcgcatggccgaggccttccgcctgtcgtcgtttagg
acgcgcttcgaggcccatgggcggttccagccctatctcgccgccatccccacctggctg
atcacccatccgctgcccgccttcgtcgggctggccggattggtgaccgatcctaaaaac
gcatag

DBGET integrated database retrieval system