KEGG   Magnetospirillum magneticum: amb2241Help
Entry
amb2241           CDS       T00305                                 

Definition
(GenBank) Methyl-accepting chemotaxis protein
Organism
mag  Magnetospirillum magneticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2444163..2444459)
Genome map
AA seq 98 aa AA seqDB search
MSDQERIIELTATLADVVSRKVEEIKKVTGTTRILALNALIEAARAGEAGKGFAVVAGEV
KNVSESIDGITQSLEAEMGAAVEELGKLAGRLRADAAE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcaggaacgtattatcgaattgaccgccaccctcgccgacgtagtgtcccgc
aaggtcgaggaaatcaagaaggttaccggcaccacccgcatcctggcgctgaacgcgctg
atcgaagccgcccgcgccggcgaggccggcaagggcttcgccgtggtggccggcgaggtg
aagaacgtgtccgaaagcatcgacggcatcacccagtcgctggaagccgagatgggcgcc
gccgtggaggaactgggcaagctggccgggcgcctgcgagccgacgccgccgaataa

DBGET integrated database retrieval system