KEGG   Magnetospirillum magneticum: amb2301Help
Entry
amb2301           CDS       T00305                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amb2301
   01230 Biosynthesis of amino acids
    amb2301
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amb2301
   00030 Pentose phosphate pathway
    amb2301
   00051 Fructose and mannose metabolism
    amb2301
   00052 Galactose metabolism
    amb2301
  Energy metabolism
   00680 Methane metabolism
    amb2301
Enzymes [BR:mag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     amb2301
Protein phosphatases and associated proteins [BR:mag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     amb2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2503322..2504407
Genome map
AA seq 361 aa AA seqDB search
MTAKRIGILTSGGDCAGLNAALRAVVHRAIRNYGWKVFGIRDGSLGLMNRPLNYVEFDLK
SVGDDMLRLGGTILGTINKGDPFAYPMPDGSKKDRSQDFVDGYKELGIEALVVIGGDGSM
RILNELCRKGGIPMVGIPKTIDNDVAQTDYAIGFATALNVAGEAMDRLAPTAASHHRVMI
LEVMGRDVGHIALNAGIAGGADVVLIPEIPYTLEGIAKKIAEVRDEGRNHALMVVAEGCK
TETGESVTTLQSGGQARYGGIGQYLAARLAETVEAETRVTVLGHVQRGGMPAMRDRIIAS
AFGVYAVDLIAQGKLGRMVAWQHGQVVDVPITDVAGITRAIDPYGTLAQTARGLGIYIGE
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaagcgtatcggaattctgaccagcggcggcgactgcgccgggttgaacgcg
gccttgcgcgcggtggttcatcgtgccatccgcaattacggctggaaggtgttcggcatt
cgcgacggcagtctcgggctcatgaaccgtcccctcaactacgtggaattcgacctgaag
tcggtgggcgacgacatgctgcgcctgggcggcaccattctcggcaccatcaacaagggc
gatcccttcgcctatcccatgcccgacgggtccaagaaggaccgctcgcaggatttcgtc
gacggctacaaggaactgggcatagaggcgctggtggtgatcggcggcgacggttccatg
cgcatcctcaacgagctgtgccgcaagggcggcatccccatggtgggcattcccaagacc
atcgacaacgacgtggcccagactgactacgccatcggcttcgccacggcgctgaacgtg
gcgggcgaggccatggaccgactggctcccacggcggccagccatcaccgcgtgatgatc
ctggaggtcatgggccgcgacgtgggccatatcgcccttaatgctggcatcgccggcggc
gccgacgtggtgctgatccccgagattccctatacgctggaaggcattgccaagaagatc
gccgaggtccgggacgaggggcgcaaccacgccctgatggtggtggccgagggctgcaag
accgagacgggcgaatcggtgaccacgctgcagagcggcggacaggcccgctatggcggc
atcggtcagtatctggcggcccggctggccgagacggtggaggccgagacccgcgtcacc
gtgctgggccatgtgcagcgcggcggcatgccggccatgcgcgaccgcatcatcgcctcg
gccttcggcgtctatgccgtcgatttgatcgcccagggcaagctgggccgcatggtggcc
tggcagcatggccaagtggtggacgtgccgatcaccgacgtggccggcatcacccgggcc
atcgatccctacggcaccctggcgcagacggcccgcggcctgggcatctatatcggcgag
atgtag

DBGET integrated database retrieval system