KEGG   Magnetospirillum magneticum: amb2318Help
Entry
amb2318           CDS       T00305                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzyme
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mag01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mag00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mag00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mag00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2521604..2522887
Genome map
AA seq 427 aa AA seqDB search
MPVQILMPALSPTMTEGNLAKWLKNEGDAVKSGDILCEIETDKATMEFEAVDEGVLGKIL
VAGGTSGVAVNTPIAVLLEEGEDASAISAISAISAAPAPKAAAPAAAAAPVTAAAPVAAP
SGPAHGGDRVVASPLAKRIAKDGNVDLKAVKGSGPHGRIVKADVEAAIKAGPAKPAAAPA
AIVAPAAKSAPAPAAASPFEPAFEEIPNSSMRKVIARRLTEAKSTIPHFYLSIDCELDAL
LKVRADLNGRSDAYKLSVNDFVVRAVALALKKAPAANASWGEEAIKRYTDIDISVAVATP
SGLITPIVHHADHKGLAEISNEMKSLAAKARDGKLKPEEFQGGGFTISNLGMFGIKEFAA
IINPPQGCILAVGAGEQRPVVKAGALAVATVMTCTLSVDHRVVDGAVGAEFLAAFKKLIE
DPLSMLL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttcaaatcctgatgcccgccctctcgccgaccatgaccgagggcaatctggcc
aagtggctgaagaacgagggtgacgccgtcaagtccggcgacatcctctgcgagatcgag
accgacaaggcgaccatggagttcgaggccgtcgacgaaggcgtgctcggcaagattctg
gtggccggcggcacctccggcgtggcggtcaacacgcccattgccgtgctgctggaagaa
ggcgaggatgcctcggccatctcggccatctcggccatctcggccgctccggcgcccaag
gcggccgctcccgccgccgctgcggcgccagttactgccgctgctccggttgccgcaccg
tcagggccggcccatggcggcgaccgtgtcgtcgcctcgcccctggccaagcgcatcgcc
aaggacggcaatgtggacctgaaggcggtgaagggctccggcccccacggccgcatcgtc
aaggccgacgtggaagccgccatcaaggccggtcccgccaagcccgccgccgccccggct
gcaattgtcgctccggcggccaagtccgcgccggcccccgccgccgccagtccgttcgag
ccggccttcgaggagattcccaactcctccatgcgcaaggtcatcgcccggcgcctgacc
gaggccaagtcgaccattccgcacttctatctcagcatcgattgcgagctggacgccctg
ctaaaggtgcgggccgacctcaacggccgttccgatgcctacaagctgtcggtcaacgac
ttcgtggtgcgtgccgtggccctggccctgaagaaggcgcccgccgccaacgcgtcgtgg
ggcgaggaggccatcaagcgctacaccgacattgacatctcggtggcggtggcgacgccg
tccggcctgatcacccccatcgtgcatcacgccgatcacaaggggctggccgaaatctcc
aacgagatgaagtccctggccgccaaggcccgtgacggcaagctgaagcccgaggagttc
cagggcggcggcttcaccatctccaatctcggcatgttcgggatcaaggagttcgccgcc
atcatcaatccgccccagggttgcatcctggcggtgggcgccggcgagcagcgtccggtg
gtcaaggccggtgccctggctgtggccacggtgatgacctgcaccctgtcggtggatcac
cgggttgtcgacggcgcggtgggggccgagttcctggcggccttcaagaagctgatcgaa
gacccgctgtccatgctgctgtag

DBGET integrated database retrieval system