KEGG   Magnetospirillum magneticum: amb2523Help
Entry
amb2523           CDS       T00305                                 

Definition
Sec-independent protein secretion pathway components
Orthology
K03117  
sec-independent protein translocase protein TatB
Organism
mag  Magnetospirillum magneticum
Pathway
Protein export
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mag00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    amb2523
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    amb2523
Secretion system [BR:mag02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   amb2523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704999..2705346)
Genome map
AA seq 115 aa AA seqDB search
MALIAVVSLIVIGPKDLPVVLRQMGRWTRKAREMASEFHRGIDDMVRESELDELKKQVTK
ATDVNLLRQEVDKAIDPTGEMAKAMELPALDMAATPEPVPQEIKPDEAPSRPPEP
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatcgccgtggtcagcctgatcgttatcggacccaaggatctgccggtggtg
ctgcgccagatgggccgctggacccgcaaggcgcgcgagatggcctcggagttccatcgc
ggcatcgacgacatggtgcgggaatccgagctggacgagttgaagaagcaggtgaccaag
gcgaccgacgtcaacctgctgcgccaggaggtcgacaaggccatcgaccccaccggggag
atggccaaggccatggagcttcccgccctcgacatggcggcgacccccgaaccggtgccg
caagagatcaagcccgacgaggcgccgagccgcccgccggaaccctag

DBGET integrated database retrieval system