KEGG   Magnetospirillum magneticum: amb2523Help
Entry
amb2523           CDS       T00305                                 

Definition
Sec-independent protein secretion pathway components
Orthology
K03117  
sec-independent protein translocase protein TatB
Organism
mag  Magnetospirillum magneticum
Pathway
Protein export
Bacterial secretion system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:mag03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:mag03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704999..2705346)
Genome map
AA seq 115 aa AA seqDB search
MALIAVVSLIVIGPKDLPVVLRQMGRWTRKAREMASEFHRGIDDMVRESELDELKKQVTK
ATDVNLLRQEVDKAIDPTGEMAKAMELPALDMAATPEPVPQEIKPDEAPSRPPEP
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgatcgccgtggtcagcctgatcgttatcggacccaaggatctgccggtggtg
ctgcgccagatgggccgctggacccgcaaggcgcgcgagatggcctcggagttccatcgc
ggcatcgacgacatggtgcgggaatccgagctggacgagttgaagaagcaggtgaccaag
gcgaccgacgtcaacctgctgcgccaggaggtcgacaaggccatcgaccccaccggggag
atggccaaggccatggagcttcccgccctcgacatggcggcgacccccgaaccggtgccg
caagagatcaagcccgacgaggcgccgagccgcccgccggaaccctag

DBGET integrated database retrieval system