KEGG   Magnetospirillum magneticum: amb2563Help
Entry
amb2563           CDS       T00305                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mag  Magnetospirillum magneticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    amb2563
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     amb2563
Exosome [BR:mag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   amb2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2746432..2747562
Genome map
AA seq 376 aa AA seqDB search
MTLGPAPQGTGPFAFMDDCSLASGGALCDVPFAVPLLEIRTVPSFLPHAQFPLTRMRRNR
RDEWQRRIVAETKLSVDDLIWPLFVVEGSGVRQAVASMPGVERLSIDLLVEEARRAADLG
IPAIAVFPSVEAALKTPDAAEAVNPGNLVCRAVRAVKKAVPTLGIICDVALDPYNSDGHD
GLVIDGYVANDSSVEALCRQAVVQAEAGCDVNAPSDMMDGRIKAIREALDQAGCDHVRLL
SYAAKYASAFYGPFRDAVGSKSALKGGDKKTYQMDPANTDEALREVALDLAEGADMVMVK
PGMPYLDIVRRVKEAFSVPTLAYQVSGEYAMMKAAALNGWLDWDKVMLESLTAFKRAGAD
AVLTYTAPEAARLLAK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttggggccggctccgcaaggaaccggccctttcgctttcatggacgattgttca
ctggcaagcgggggggcattatgcgatgtcccgtttgccgtccccctgctggagatccgg
accgtgccgtcctttctgccccacgcccaattccccctcacccgcatgcgccgcaaccgc
cgcgacgaatggcagcgccgcatcgtcgccgagaccaagctgtcggtggacgatctgatc
tggccgctgttcgtggtcgagggcagcggcgtgcgacaggcggtggcgtccatgcctggc
gtcgagcgcctgtccatcgatctgctggtcgaagaggcgcgccgcgccgccgatctgggg
attcccgccatcgcggtcttcccctcggtggaggccgccctgaagacccccgacgccgcc
gaggcggtcaatcccggcaatctggtctgccgggcggtgcgcgccgtcaagaaggcggtt
cccactctcggcatcatctgcgacgtggcgctggacccctacaacagcgacggccatgac
gggctggtgatcgacggctatgtggccaacgattcctcggtcgaggcgctgtgccgccag
gcggtggtccaggccgaagccggctgcgacgtcaacgccccctcggacatgatggacggc
cgcatcaaggcaattcgcgaggccctggaccaggccggttgcgaccatgtgcgcctgctg
tcctatgccgccaaatacgcctcggccttctacggcccgttccgcgacgcggtgggctcc
aagtcggcgctgaagggcggcgacaagaagacctaccagatggacccggccaataccgac
gaggccctgcgcgaagtggcgctggatctggccgagggcgccgacatggtgatggtcaag
cccggcatgccctatctggacatcgtccgccgggtcaaggaggccttctccgtccccacc
ctggcctatcaggtgtcgggcgagtacgccatgatgaaggccgccgcgctgaacggctgg
ctggactgggacaaggtgatgctggaaagcctgacggccttcaagcgcgccggtgccgac
gccgtgctcacctacaccgcccccgaggcggcccgcctgctggcaaagtag

DBGET integrated database retrieval system