KEGG   Magnetospirillum magneticum: amb2735Help
Entry
amb2735           CDS       T00305                                 

Definition
Alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mag  Magnetospirillum magneticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    amb2735
  Lipid metabolism
   00561 Glycerolipid metabolism
    amb2735
   00600 Sphingolipid metabolism
    amb2735
Enzymes [BR:mag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     amb2735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2920528..2921805
Genome map
AA seq 425 aa AA seqDB search
MKNITKIAFLGAGSMSFGLSTFRDMFSSDTLAGSTLVLVDHNPEALARMKALAERMNAEG
KAGMIIESTTDRREAFDGASVVINSVAIDRMRLWKHDFEIPKKYGIRQTLGENGGPGGLF
FTMRTLPLIFEITRDMEELCPDALFLNFSNPESRIVLALGKYSPIKSMGLCHGIFMARGA
ICHITGVPWHDAECWGIGLNHFQWMLQVRNRWTGEDMYPLLRAKEPGFDPTFQPFSRKMF
NIYGLWPSCSDDHMGEYLAFGWEGGEHGHDYAGDARERVELQEAIEGVLAGGPLPDEWKH
SVGERTNVVVDGLINNRHHYLESAVLMNNGTIPNLPPDLAVEVPAIVDAAGVHPVSLGPL
PESIQKLALVQAGVQQLSVEAAVHASKELALQALLADPVVNSSDAAVKLLDELWEINKPY
IRKCV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatcaccaagatcgcctttctcggcgccggcagcatgtcgttcggcctgtcc
accttccgcgacatgttctcgtcggacaccctggccggctccaccctggtgctggtggac
cataatcccgaggccctggcccgcatgaaggccctggccgagcgcatgaatgccgagggc
aaggccggcatgatcatcgaaagcaccaccgatcgccgcgaagccttcgacggcgcctcg
gtggtaatcaattcggtggccatcgaccgcatgcggctgtggaagcatgatttcgagatt
cccaaaaaatacggcatccgccagaccctgggcgagaacggcgggccgggcgggctgttc
ttcaccatgcggaccctgccgctgatcttcgagatcacccgggacatggaggaactgtgc
cccgacgccctgttcctcaacttttccaacccggaaagccgcatcgtgctggcgctgggc
aagtacagccccatcaagtccatggggctgtgccacggcatcttcatggcccggggcgcc
atctgccacatcaccggggtgccatggcacgacgccgagtgctgggggatcggcctcaat
cacttccagtggatgctgcaggtccgcaaccgctggaccggcgaggacatgtatcccctg
ctgcgggccaaggagcccggcttcgaccccactttccagccgttcagccgcaagatgttc
aatatctacggcctgtggccgagctgcagcgacgaccacatgggcgagtacctggccttc
ggctgggaaggcggcgagcacggccacgactatgccggcgacgcccgggaacgggtggaa
ctgcaagaggccatcgagggtgtcctggcgggcggccccctgcccgacgaatggaagcac
tcggtgggcgagcgcaccaacgtggtggtcgacggcctgatcaacaaccgccaccactac
ctggaatcggcggtgctgatgaacaacggcaccatccccaacctgccgcccgacctggcg
gtcgaggttccggccatcgtggacgcagccggagtgcatcccgtctcgctggggccgctg
cccgaatcgattcagaagctggccctggttcaggccggcgtgcagcaattgtcggtggaa
gccgcggtgcacgcctccaaggaactggcgctgcaggcgctgctggccgatcctgtggtc
aattcctcggacgccgcggtcaagctgttggacgaattgtgggagatcaacaagccctat
atccgcaaatgcgtctga

DBGET integrated database retrieval system