KEGG   Magnetospirillum magneticum: amb2863Help
Entry
amb2863           CDS       T00305                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01130  Biosynthesis of antibiotics
mag01230  Biosynthesis of amino acids
Module
mag_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    amb2863
Enzymes [BR:mag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     amb2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAE51667
UniProt: Q2W3A8
Position
3063963..3064778
Genome map
AA seq 271 aa AA seqDB search
MNATPTILDRICSEKRKQVAEQKSRRPIQELLKRAQDQAPPRGFAASLDRKVAEIGWGLI
TEIKKASPSAGIIRADFKPEFLARAYQRGGAACLSVLTDQKFFQGTDADLGAARSACDIP
VLRKDFMVDPYQIVEARALGADCILLIVASLTDAELSQMEDIALGYGMDVLIEVHDEAEL
ERALKLKSPLIGINNRDLRIMKTDLATTERLVPLIPAGKVVVSESGLEGPGDLRRMAAVG
VKRFLIGEALMRRPDVEQAVKVLLAGAGPAT
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccaccccgaccatcctcgaccgcatctgctccgaaaagcgcaagcaggtcgcc
gagcagaagagccgccgccccatccaggagctgctgaagcgtgcccaggaccaggcgccg
ccccgcggcttcgccgcctcgctggaccgcaaggtcgccgagatcggctggggcctgatc
accgagatcaagaaggcctcgccctccgccggcatcatccgcgccgacttcaagccggaa
ttcctggcgcgggcctaccagcgcggcggcgccgcctgcctgtccgtcctgaccgaccag
aagttcttccagggcaccgacgccgatctgggcgcggcgcgttcggcctgcgacattccg
gtgctgcgcaaggatttcatggtcgatccctaccagatcgtcgaggcccgcgccctgggg
gccgactgcatcttgctgatcgtcgcctcgctgaccgatgccgagctcagccagatggag
gacatcgccctgggctacggcatggacgtgctgatcgaagtccatgacgaggccgagctg
gagcgggcgctgaagctcaagtctcccctgatcggcatcaacaaccgcgacctcaggatc
atgaagaccgacctcgccaccaccgagcgtctggtcccgctgatccccgccggcaaggtg
gtggtgtcggaaagcggcctggaaggccccggcgatctgcgccgcatggcggcggtgggc
gtcaagcgcttcctgatcggcgaggccctgatgcgccgccccgacgtggagcaggcggtc
aaggtgctgctggccggcgccggtccggccacctga

DBGET integrated database retrieval system