KEGG   Magnetospirillum magneticum: amb3063Help
Entry
amb3063           CDS       T00305                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mag  Magnetospirillum magneticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    amb3063
Enzymes [BR:mag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     amb3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3309274..3311466)
Genome map
AA seq 730 aa AA seqDB search
MSGTDALDRLARLAGIEDGWWDFFGEWRVVPPQTKRVFLAAMGLPADSDEQVWASLKDLE
SRPWRRTLDPVLMAEEHSSPPSIAVTLPAEADDFEHSWVLEEELGIRHTGTFRPGELRWG
EEYQLDGRLIHRRWLDLPALPPCGYHRLTLSGPKGALGEMALIVTPPRAFVPEVVERDTG
AWGIATQVYSLRSERDWGVGTYGNLAELAEGAARMGAACVGINPLHALFPADPERFSPYS
PSSRRFLNIAYIDIEAIPEFAECLEAKRMFASPGYQANLARLRGYPLIDYPDVMRLARPM
LEVLYRWFRRTCMGEDNPRGQAFRAFQIEQGVSGRRFAVFEALHDRFSRDGTPYWRQWPA
EFRRPESPAIADFAVEHVEQVELFQWLQFIADEQLGEAQNRAKAAGAAIGLYRDLAVGIA
GDGAEAWAQQDSLALGVSVGAPPDPLALKGQDWGLVPFNPVTLRENFYAPFIEVMQANMR
HAGALRLDHAMSLARLYWVPPGQPADQGAYVRYPVEDLFRLVALESQRNRCLVIGEDLGT
VPDGFRERMDRMGIFAYRVMVFEKTKDGAVRPPREFDAKALAIAATHDLPSLRGWWAGKD
IDRREKLDLYPREGQAAEERQARAADRVAMVAALAGQGLLPADFPASPALTDVQAVALSA
AVHAYLGRSASRLMMVQMEDVLGQELQMNLPGTTIQHPNWRLRYKAESAAILADRRMVAT
AEALRDAGRT
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaccgacgctctggaccgtttggcgcggctggcgggaatcgaggacggctgg
tgggacttcttcggcgaatggcgcgtggtgccgcctcagaccaagcgggtcttcctggcc
gccatggggctgcccgccgacagcgacgagcaggtctgggccagtctcaaggatctggaa
agccgtccttggcgccggacactggacccggtgctgatggccgaagagcattcgtccccg
ccctccatcgccgtcaccctgccggccgaggccgatgatttcgagcattcctgggtgctg
gaagaggaactgggcatccgccacaccggcaccttccggcccggcgaattgcgctggggc
gaggagtaccagctggacggacggctgatccatcgccgctggctggacctgccggcgctt
ccgccttgcggctatcaccgcctgaccctgtccggccccaagggggcgctgggcgagatg
gcgctgatcgtcaccccgccgcgggccttcgtgcccgaggtggtggagcgcgataccggc
gcctggggcatcgccacccaggtctattccctgcgctccgagcgcgactggggggtgggc
acctacggcaatctggccgaactggccgagggcgcggccaggatgggggcggcctgcgtc
ggcatcaatccgctgcatgccctgttccccgccgatcccgagcgcttcagcccctattcc
ccctcgtcgcggcgctttctcaacatcgcctatatcgatatcgaggccatccccgagttc
gccgaatgcctggaggccaagcgcatgttcgcttcgcccggctatcaggccaatctggcg
cggctgcgcggctatccgctgatcgactatcccgacgtcatgcgcctggcgcggcccatg
ctggaagtgctgtaccgctggttccgccggacctgcatgggcgaggacaatccgcgcggc
caggccttccgcgccttccagatcgagcagggcgtgtcggggcggcgcttcgcggtgttc
gaggctctgcacgacaggttcagccgcgacggcaccccctattggcgacagtggccggcg
gagttccgccgtcccgagtctcccgccatcgccgattttgcggtcgagcatgtggagcag
gtcgagctgttccagtggctgcagttcatcgccgacgagcagctgggtgaggcgcagaat
cgggccaaggcggcgggggccgccatcggcctttaccgcgacctggcggtgggcattgcc
ggcgacggcgccgaggcctgggcccagcaggattccctggccctgggcgtctcggtgggg
gcgccccccgatcccctggcgctcaaggggcaggattgggggctggtgccgttcaatccc
gtcacgctgcgagagaatttctacgcccccttcatcgaggtgatgcaggccaatatgcgc
catgccggggcgctgcgcctggaccacgccatgagcctggcgcggctgtactgggtgccg
ccgggccagcccgccgaccagggcgcctatgtgcgctatccggtcgaggatctgttccgg
ctggtggcgctggaaagccagcgcaatcgctgtctggtgatcggtgaggatttgggcacc
gtccccgacggcttccgcgagcgcatggaccggatgggcatcttcgcctaccgggtgatg
gtgttcgaaaagaccaaggatggcgccgtgcgcccgccgcgggagttcgatgccaaggcc
ctggccatcgccgccacccacgacctgccgtccctgcgcggctggtgggcgggcaaggac
atcgatcgccgggaaaagctcgatctttatccccgcgagggacaggcggcggaagagcgg
caggcccgcgccgccgaccgcgtcgccatggtggcggcgctggcgggccaaggcctgctg
cccgccgatttcccggcgagtcccgcgctcacggatgtccaggctgtcgccctgtcggcg
gccgttcacgcctatctcggccgctccgcctcccggctgatgatggtgcagatggaagac
gtcctgggccaggaactccagatgaacctgcccggcaccaccatccagcatcccaattgg
cgcctgcgctacaaggccgagtcggcggccattctggccgaccggcgcatggtggcgacg
gccgaggccttgagggatgccggccgtacgtaa

DBGET integrated database retrieval system