KEGG   Magnetospirillum magneticum: amb3218Help
Entry
amb3218           CDS       T00305                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mag  Magnetospirillum magneticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    amb3218 (ruvA)
Enzymes [BR:mag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     amb3218 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483969..3484607)
Genome map
AA seq 212 aa AA seqDB search
MIAKLKGLIDSLGDDWAVVDCNGVGYLVACSSKTLARLETGTAAALFVETQVREDAISLF
GFLETGERDWFRLLTTVQGVGAKVALAILSVASPDQLLQIIAAQDKAGLTRANGVGPKLA
VRILTELKDKAGKIALGGFSPGGIKDALSASAPLPAASGRMEDAVSALVNLGYKRLEAFQ
AVGETARELGDEADSSALIRAALKHLGKGLLG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccaagctgaagggcctgatcgattccctcggcgacgactgggccgtggtggat
tgcaacggcgtcggctatctggtggcctgctcgtccaagaccctggcgcggctggagacc
ggcaccgccgccgccctgttcgtcgagacccaggtgcgggaagacgccatctcgctgttc
ggctttttggaaaccggcgagcgcgactggttccggctgctgaccacggtgcagggggtt
ggggccaaggtagccctggccattctgtcggtggcctcgccggaccagctgctgcagatc
atcgcggcccaggacaaggccgggctgacccgggccaacggcgtcgggccgaaactggcg
gtgcgtatcctcaccgagttgaaggacaaggccggcaagatcgccctggggggcttctct
cccggtgggatcaaggacgcgctgtcggcttcggcgccgctgcccgccgcctcgggccgc
atggaggacgccgtctccgccctggtcaatctgggctacaagcgcctggaggccttccag
gcggtgggcgagaccgcccgcgagctgggggacgaggcggactcgtccgccctgatccgc
gccgccctgaagcacctgggcaaggggctgctgggatga

DBGET integrated database retrieval system