KEGG   Magnetospirillum magneticum: amb3342Help
Entry
amb3342           CDS       T00305                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00340  Histidine metabolism
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    amb3342
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     amb3342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAE52146
UniProt: Q2W1X9
Position
complement(3632111..3633412)
Genome map
AA seq 433 aa AA seqDB search
MVQSLDSRDSGFEAAFLALLAMKREVDEDVDQAVAAILAEVRSRGDAALIEYTARFDRLE
LTPATLRITAQEVETAYASCDPELIRALELAAERIRAFHARQVPVDDSFTDAAGVRLGLR
WSPVSAAGLYVPGGTAAYPSSVLMNAIPAKAAGVERLVMVVPSPGGVLNPLVLAAAKVAG
VDEIYRVGGAQAVGALAYGTGTIRPVDKIVGPGNAWVAAAKRRVFGTVGIDMIAGPSEIL
VVADRFNDPSWIAADLLSQAEHDTAAQSILITDDAEFGQRVAAAVESHLATLPRAKIARE
SWDSHGAIIVVPDLEASLPLIDRIAPEHLELAVENPDALAARVRNAGAIFLGRYTPEAVG
DYIGGPNHVLPTARSARFSSGLGVLDFMKRTTLLGCDADSLRAIGPAAVRLAEAEGLGAH
GLSVALRLNLGAG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagagtctcgactcccgcgattccgggttcgaagcggccttcctggccctgttg
gccatgaagcgcgaggtggacgaggacgtggatcaggcggtggccgccatcctggccgaa
gtgcgcagtcgcggcgacgccgccctgatcgagtacaccgcccgttttgaccggctggag
ctgacgcctgccaccctgcgcatcaccgcgcaggaggtggagaccgcctatgcctcctgc
gatcccgaactgatccgtgccctggaactggccgccgagcgcatccgcgccttccacgcc
cgccaggtgcccgtcgacgattccttcaccgatgccgccggagtgcggctggggctgcgc
tggagcccggtttccgccgccggcctgtatgtgccgggcggcaccgccgcctatccctcc
tcggtgctgatgaacgccattcccgccaaggccgccggcgtcgagcgtctggtgatggtg
gtgccgtcgcccggcggcgtgctcaacccgctggtcctggccgccgccaaggtggcgggc
gtggacgagatctaccgcgtcggcggcgcccaggcggtgggcgcgctggcctatggcacc
gggaccatccgcccggtggacaagatcgtcggccccggcaacgcctgggtggccgccgcc
aaacgccgggtgttcggcacggtgggcatcgacatgatcgccgggccgtcggaaatcctg
gtggtggccgaccgcttcaacgatccctcctggatcgccgccgacctgctgagccaggcc
gagcacgataccgccgcgcaaagcatcctgatcaccgatgacgccgagttcggccaaagg
gtggcggcggcggtggagtcgcacctggcgaccctgccgcgtgccaagatcgcccgggaa
agctgggacagccacggcgccatcatcgtggtgcccgatctggaggcctcgctgccgctg
atcgaccgcatcgcgcccgagcatctggagctggcggtggagaatcccgacgccctggcc
gcccgggtgaggaacgccggcgccatcttcctggggcgctatacccccgaagcggtgggc
gattatatcggcggtcccaaccatgttctgcccacggcgcgctcggcccgtttctcctcg
ggcctcggcgtgctggactttatgaagcgcaccaccctgctgggctgcgacgcggattcc
ctgcgggccatcggcccggcggcggtgcgtctggccgaggcggaaggcctcggcgcccac
ggtctgtcggtggcgttacggctcaacctgggggccggctga

DBGET integrated database retrieval system