KEGG   Magnetospirillum magneticum: amb3426Help
Entry
amb3426           CDS       T00305                                 

Definition
cytochrome C2, iso-2
Orthology
K08738  
cytochrome c
Organism
mag  Magnetospirillum magneticum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    amb3426
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amb3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3754664..3755020)
Genome map
AA seq 118 aa AA seqDB search
MKLQLAAFAAALALAGTALAAEPPAAFSACKTCHKVEAGANGIGPSLHGVAGSKAGTAAA
GFKYSPALTGWGKSWDDANLAAYIANPKDTIPGNKMVFAGLKNPADVSAMVEYLKTLK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcagcttgccgccttcgccgcagccttggccctggccggtaccgctctggcc
gccgagccgccggccgctttttcggcctgcaagacctgtcacaaggtggaagccggcgcc
aacggcatcggtcccagcctgcacggcgtggccgggtccaaggccggcaccgccgcggcg
ggattcaagtactcgccggctctgaccggctggggcaagtcctgggacgacgccaatctg
gcggcctacatcgccaatcccaaggacaccatccccggcaacaagatggtgttcgccggc
ctcaagaacccagcggacgtctccgccatggtcgagtacctgaagaccctgaagtag

DBGET integrated database retrieval system