KEGG   Magnetospirillum magneticum: amb3426Help
Entry
amb3426           CDS       T00305                                 

Definition
(GenBank) Cytochrome C2, iso-2
  KO
K08738  cytochrome c
Organism
mag  Magnetospirillum magneticum
Pathway
mag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amb3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAE52230
UniProt: Q2W1P5
Position
complement(3754664..3755020)
Genome map
AA seq 118 aa AA seqDB search
MKLQLAAFAAALALAGTALAAEPPAAFSACKTCHKVEAGANGIGPSLHGVAGSKAGTAAA
GFKYSPALTGWGKSWDDANLAAYIANPKDTIPGNKMVFAGLKNPADVSAMVEYLKTLK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcagcttgccgccttcgccgcagccttggccctggccggtaccgctctggcc
gccgagccgccggccgctttttcggcctgcaagacctgtcacaaggtggaagccggcgcc
aacggcatcggtcccagcctgcacggcgtggccgggtccaaggccggcaccgccgcggcg
ggattcaagtactcgccggctctgaccggctggggcaagtcctgggacgacgccaatctg
gcggcctacatcgccaatcccaaggacaccatccccggcaacaagatggtgttcgccggc
ctcaagaacccagcggacgtctccgccatggtcgagtacctgaagaccctgaagtag

DBGET integrated database retrieval system