KEGG   Magnetospirillum magneticum: amb3583Help
Entry
amb3583           CDS       T00305                                 

Definition
(GenBank) Enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00071  Fatty acid degradation
mag00280  Valine, leucine and isoleucine degradation
mag00281  Geraniol degradation
mag00310  Lysine degradation
mag00360  Phenylalanine metabolism
mag00362  Benzoate degradation
mag00380  Tryptophan metabolism
mag00410  beta-Alanine metabolism
mag00627  Aminobenzoate degradation
mag00640  Propanoate metabolism
mag00650  Butanoate metabolism
mag00903  Limonene and pinene degradation
mag00930  Caprolactam degradation
mag01100  Metabolic pathways
mag01110  Biosynthesis of secondary metabolites
mag01120  Microbial metabolism in diverse environments
mag01130  Biosynthesis of antibiotics
mag01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    amb3583
   00650 Butanoate metabolism
    amb3583
  Lipid metabolism
   00071 Fatty acid degradation
    amb3583
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amb3583
   00310 Lysine degradation
    amb3583
   00360 Phenylalanine metabolism
    amb3583
   00380 Tryptophan metabolism
    amb3583
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    amb3583
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    amb3583
   00281 Geraniol degradation
    amb3583
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amb3583
   00627 Aminobenzoate degradation
    amb3583
   00930 Caprolactam degradation
    amb3583
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     amb3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 2_5_RNA_ligase2
Motif
Other DBs
NCBI-ProteinID: BAE52387
UniProt: Q2W188
Position
complement(3934003..3935040)
Genome map
AA seq 345 aa AA seqDB search
MMSAEIHFDRTGHLGRITLDRPKALNALTLDQVHAMHPRLDQWAADADVACITIEGAGEK
AFCAGGDIKQLYEACKAGDLEFAAAFYRDEYRLNRRIHTSPKPYVALIDGIVMGGGVGVS
VHGLYRVATERTLFAMPETGIGFFPDVGGSYFLPRLPGSIGMYLGLTGARLKAADTLHVG
VATHFVESAQLPALIEALSEARDAAEVKASLDGFASDPGPAAIDARRELIDRCFGKASLA
EVFAALEGESDPFAAETLATIRAKSPHLVAVSFEMIRRGATLSFDDCMKMEFRLAMALAP
AHDFVEGVRALLIDRDNKPAWNPAGTEGQVLAHFDAVPGCGDLTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtctgctgaaatccatttcgaccgcaccggccatctgggccgcatcaccctggac
cggcccaaggcgctgaatgccctgacgctggatcaggtgcacgccatgcatccccgcctc
gaccagtgggcggctgatgccgacgtggcctgcatcaccatcgagggcgcgggcgagaag
gcgttctgcgccggcggcgacatcaagcagctttacgaggcctgcaaggccggagacctg
gaattcgccgccgccttctaccgcgacgaataccgcctcaaccgccgcattcacaccagc
cccaagccctatgtggcgcttatcgacggcatcgtcatgggcggcggcgtgggggtgtcg
gtgcacggcctgtaccgggtcgccaccgagcgcaccctgttcgccatgcccgagaccggc
atcggcttcttccccgatgtgggcggatcgtacttcctgccccggctgccgggctccatc
ggcatgtatctcggcctgacgggagcgcggctgaaggcggccgataccctgcatgttggc
gtcgccacccatttcgtggaaagcgcccagcttcccgccctgatcgaggcgctgtccgag
gcccgcgacgccgccgaggtcaaggccagcctggacggctttgcttccgaccccggcccg
gcggccatcgacgcccggcgagagttgatcgaccgctgtttcggcaaggccagtctggcc
gaggtctttgcggcgctcgaaggcgaaagcgatcccttcgccgccgagaccctggccacc
atccgcgccaagtcgccccatctggtggcggtcagcttcgagatgatccgccgcggcgcc
accctgtccttcgacgattgcatgaagatggagttccgcctggccatggcgctggcgccc
gcccatgacttcgtcgaaggcgtgcgcgccctgctcatcgaccgtgacaacaagcccgcc
tggaacccggcggggacggaaggccaggtgctggcccatttcgacgcggtgccgggctgt
ggggatttgaccttttaa

DBGET integrated database retrieval system