KEGG   Magnetospirillum magneticum: amb3583Help
Entry
amb3583           CDS       T00305                                 

Definition
enoyl-CoA hydratase/carnithine racemase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mag  Magnetospirillum magneticum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    amb3583
  Carbohydrate metabolism
   00640 Propanoate metabolism
    amb3583
   00650 Butanoate metabolism
    amb3583
  Lipid metabolism
   00071 Fatty acid degradation
    amb3583
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amb3583
   00310 Lysine degradation
    amb3583
   00360 Phenylalanine metabolism
    amb3583
   00380 Tryptophan metabolism
    amb3583
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    amb3583
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    amb3583
   00281 Geraniol degradation
    amb3583
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amb3583
   00627 Aminobenzoate degradation
    amb3583
   00930 Caprolactam degradation
    amb3583
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     amb3583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3934003..3935040)
Genome map
AA seq 345 aa AA seqDB search
MMSAEIHFDRTGHLGRITLDRPKALNALTLDQVHAMHPRLDQWAADADVACITIEGAGEK
AFCAGGDIKQLYEACKAGDLEFAAAFYRDEYRLNRRIHTSPKPYVALIDGIVMGGGVGVS
VHGLYRVATERTLFAMPETGIGFFPDVGGSYFLPRLPGSIGMYLGLTGARLKAADTLHVG
VATHFVESAQLPALIEALSEARDAAEVKASLDGFASDPGPAAIDARRELIDRCFGKASLA
EVFAALEGESDPFAAETLATIRAKSPHLVAVSFEMIRRGATLSFDDCMKMEFRLAMALAP
AHDFVEGVRALLIDRDNKPAWNPAGTEGQVLAHFDAVPGCGDLTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtctgctgaaatccatttcgaccgcaccggccatctgggccgcatcaccctggac
cggcccaaggcgctgaatgccctgacgctggatcaggtgcacgccatgcatccccgcctc
gaccagtgggcggctgatgccgacgtggcctgcatcaccatcgagggcgcgggcgagaag
gcgttctgcgccggcggcgacatcaagcagctttacgaggcctgcaaggccggagacctg
gaattcgccgccgccttctaccgcgacgaataccgcctcaaccgccgcattcacaccagc
cccaagccctatgtggcgcttatcgacggcatcgtcatgggcggcggcgtgggggtgtcg
gtgcacggcctgtaccgggtcgccaccgagcgcaccctgttcgccatgcccgagaccggc
atcggcttcttccccgatgtgggcggatcgtacttcctgccccggctgccgggctccatc
ggcatgtatctcggcctgacgggagcgcggctgaaggcggccgataccctgcatgttggc
gtcgccacccatttcgtggaaagcgcccagcttcccgccctgatcgaggcgctgtccgag
gcccgcgacgccgccgaggtcaaggccagcctggacggctttgcttccgaccccggcccg
gcggccatcgacgcccggcgagagttgatcgaccgctgtttcggcaaggccagtctggcc
gaggtctttgcggcgctcgaaggcgaaagcgatcccttcgccgccgagaccctggccacc
atccgcgccaagtcgccccatctggtggcggtcagcttcgagatgatccgccgcggcgcc
accctgtccttcgacgattgcatgaagatggagttccgcctggccatggcgctggcgccc
gcccatgacttcgtcgaaggcgtgcgcgccctgctcatcgaccgtgacaacaagcccgcc
tggaacccggcggggacggaaggccaggtgctggcccatttcgacgcggtgccgggctgt
ggggatttgaccttttaa

DBGET integrated database retrieval system