KEGG   Magnetospirillum magneticum: amb3615Help
Entry
amb3615           CDS       T00305                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mag  Magnetospirillum magneticum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    amb3615
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    amb3615
Enzymes [BR:mag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     amb3615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3968468..3969193)
Genome map
AA seq 241 aa AA seqDB search
MINMQSAGSSVQKGETLIDTAMTLNAMHLDVLVVRHPDSGAVKLLSEKVNCAVINGGDGS
HEHPTQALLDALTIRRRKGKLSGLNVAICGDVRHSRVARSNIYLLNAMGAHVRLIGPRTL
LPSGLDRMGVEVFHDMRKGLADVDVIMMLRIQNERMSGNFIPSIREYFHFFGLDREKLGI
AKPDAVIMHPGPMNRGVEIDSDVADDVERSLIRSQVEMGVAVRMACLDMLTRDLTRSEGA
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacatgcagtcggcgggctcgtcggtgcagaagggcgagaccctgatcgacacc
gccatgacgctcaacgccatgcatctggacgtgctggtggtgcgccacccggattcgggc
gcggtcaagctgctgagcgaaaaggttaattgcgccgtgatcaacggcggcgacggcagc
cacgagcaccccacccaggccttgctcgacgccctgaccatccggcgccgcaagggcaaa
ctgtcgggcctcaacgtcgccatctgcggcgacgtgcgccattcccgcgtggcccgctcc
aacatctacctgctcaacgccatgggcgcccatgtgcgcctgatcggcccgcgcaccctg
ttgccctcgggcctcgaccgcatgggcgtcgaggtcttccacgacatgcgcaagggtctg
gccgacgtggacgtcatcatgatgctgcgcatccagaacgagcgcatgagcggcaatttc
atccccagcatccgcgagtacttccacttcttcggcctggaccgcgagaagctgggcatc
gccaagcccgatgcggtgatcatgcatcccggtcccatgaaccgcggcgtcgagatcgat
tccgacgtggccgacgacgtggaacgctcgctgatccgttcgcaggtggagatgggcgtg
gcggtgcgcatggcctgcctggacatgctgacccgcgacctgacccgctcggaaggagcc
gtctga

DBGET integrated database retrieval system