KEGG   Magnetospirillum magneticum: amb3627Help
Entry
amb3627           CDS       T00305                                 

Definition
phospholipid hydroperoxide glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mag  Magnetospirillum magneticum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    amb3627
  Metabolism of other amino acids
   00480 Glutathione metabolism
    amb3627
Enzymes [BR:mag01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     amb3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3988353..3988979
Genome map
AA seq 208 aa AA seqDB search
MGLLHHLQESTEVLMHRFLPANPLGSFVASMVATIGLAGSLAAATPNDRLDWASVPLPAI
NGGQLPPASLKGKVVLVVNTASQCGFTPQYQGLEALWRRYRERGLVVLGVPSNDFGAQEP
GSNTEVASFCEINYGVDFPLLEKQAVTGAGAHPFYRWAAERTGPLGVPRWNFHKILVGRD
GGMVDWFASTTAPDAERLRAAIDKALSP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcttcaccatttgcaggaaagcacggaggtcctcatgcatcgttttctccca
gccaatcccctcggctcgttcgtggccagcatggtcgccaccatcggtctggcgggcagc
ctggctgccgccacgcccaacgaccggctcgattgggcatcggttccgcttcccgccatc
aatggcgggcaactgcccccggcctccctgaagggcaaggtcgtgctggtggtcaacact
gcctcgcaatgcggcttcactccgcaataccaggggctggaggccctgtggcgccggtac
cgcgagcgcgggctggtggtgctgggcgtgccgtccaacgatttcggcgctcaggagccg
ggcagcaataccgaggtcgccagcttctgcgagatcaattacggcgtcgacttccccctg
ctggaaaagcaggcggtgaccggcgcgggcgcccatcccttctaccgctgggcggcggaa
cggaccgggccgctgggcgttccgcgctggaatttccacaagatcctggtgggccgcgac
ggaggaatggtcgactggttcgccagcaccacggcgcccgacgccgaacgcctgcgcgcc
gccatcgacaaggcgctcagcccatga

DBGET integrated database retrieval system