KEGG   Magnetospirillum magneticum: amb3654Help
Entry
amb3654           CDS       T00305                                 

Definition
(GenBank) Hypothetical 1041 kDa protein in hypE 3'region
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mag  Magnetospirillum magneticum
Pathway
mag02020  Two-component system
mag02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mag00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    amb3654
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    amb3654
Enzymes [BR:mag01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     amb3654
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     amb3654
Two-component system [BR:mag02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   amb3654
Bacterial motility proteins [BR:mag02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    amb3654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 CheR_N PAS_4 AIP3 IncA CENP-F_leu_zip Rootletin ATG16 Spc7 Golgin_A5 Laminin_II Leu_zip HMMR_N Mnd1 Exonuc_VII_L Snapin_Pallidin DUF1664 Med30 DUF3584 PAS_9 IFT57 V_ATPase_I Atg14 DUF4795 GAS HOOK DUF3552 DUF3450 TBPIP KxDL FapA Baculo_gp64 HIP1_clath_bdg APG6 CALCOCO1 NRBF2 LXG LMBR1 ADIP AAA_13 DUF812 Fusion_gly Fmp27_WPPW
Motif
Other DBs
NCBI-ProteinID: BAE52458
UniProt: Q2W117
Position
complement(4016777..4019647)
Genome map
AA seq 956 aa AA seqDB search
MTSKTLPQPPAAELSIVGLGGSAGGLEAFEAFFRNLPADTGMGFVLVSHLDPSHTSILTE
ILQRTTVMPVVEAADQMLVEANRVYVIPPNRDMTLFQSRLQLSLPEQPRGQRMPIDAFLR
SLADDRGEHAIGIVLSGTGSDGTLGLRAILGGGGISLVQDPATAQYDGMPLSAIQAGFAT
HVLAPERMPAILQANRRHHAEISPAPATIGGMSRIMMLLRSGTGHDFSGYKKSTIGRRIE
RRMAQHDIEDIEVYARYLKAHPAETQTLFKELLINVTSFFRDPEAFAILKKDILPQILAG
KPDDYVVRLWVAGCATGEEAYSIAMVLREVMEESGRELKAQIYSTDLDDDAIATARTGFY
PVNITQDVSPERLRRFFVKEENGYRVKKDIREMVVFAIQNVIKDPPFTRMDLVSCRNLMI
YLEADLQGRLIPAFHYALRPGGVLFLSPSESIGGHTELFSPLNRKWKFYRTAPSLASTRA
MMASGLAWTTDATRSPPVEVMTKTKDTNIAEMTRRALVQSFAPVSVMTDSKGDILYVHGD
TSRYLRPPPGQATLNAVEMAHEGLQLEMRSALGQAVSHGTPTLEREVSFMVGAEVRRVRL
GVRPLPDPEPGLGLVLISFQDLPVSDPGKPARRRRAPSSADRERIEELERDLAYTRENLQ
ATIEEQQSSNEELKSANEELQSTNEELQSTNEELETSKEELQSVNEELITVNAELQAKIE
QLAGMQNDMKNLLDNINVGTIFLDDRLAIRRFTREAAKVYRLVTTDVGRPLADIKSDLGG
DDLLAQAQQVIDTLIPFEREVRTIGGDWYLTRIQPYRTLDNVIDGVVITFSNVTARVAAE
QAEQEGHDIAESIVDAVDKPLLVLDGAFSVIFASNSFYRDFKVSPGEARGRSIYSLDYIA
WDSPALKDLLENVLPRKQSFSAFPLDSHKMRLGGRRIVCRTSGKPLILLTFEKDTA
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcaagaccttgcctcagccccccgcggccgaactgtccattgtcggtctgggg
gggtcggccggcggcctggaggcgttcgaggccttctttcgcaatttgccggccgataca
ggcatgggcttcgttctggtttcccatctcgaccccagccacaccagcatcctgaccgag
attctgcagcggaccaccgtcatgccggtggtcgaggctgccgaccagatgctggtcgag
gccaaccgggtctacgtcattccgcccaaccgcgacatgaccctgtttcagagccgtttg
cagttgagcctgccggaacagccccgcggccagcgcatgcccatcgacgcctttctgcgc
tcgctggccgatgatcggggcgaacacgccatcggcatcgtcctgtcgggcaccggctcg
gacggcactctgggcctgcgcgccattctggggggcggcggcatcagcttggtgcaggac
ccggccaccgcccaatacgacggcatgccgctcagcgccatccaggccggcttcgccacc
catgtgctggcgcccgagcggatgcccgccatcttgcaggccaatcgccgccaccatgcc
gagatttcgcctgccccggcgaccatcggcggcatgagcaggatcatgatgctgctgcgc
tcggggaccgggcacgacttttccggctacaagaaaagcaccatcggccggcgcatcgag
cggcgcatggcccagcacgatattgaggatattgaggtttatgcccgttatctcaaggcg
catcccgccgagacccagaccctgttcaaggagttgctgatcaacgtcaccagcttcttc
cgcgaccccgaagccttcgccatcctgaaaaaggacatcctgccgcagatccttgccggc
aagcccgacgattacgtggtccggctatgggtcgccggctgcgccaccggcgaggaggcc
tattccatcgccatggtcctgcgcgaggtcatggaggaatccggtcgtgaactgaaggct
cagatctacagcaccgatctcgacgacgacgccatcgccacggcgcgcacgggcttttac
cccgtcaacattacccaggacgtctcgcccgaacggctgcgccgcttcttcgtcaaggag
gagaacggctaccgggtgaagaaggacatccgcgagatggtggtgttcgccatccagaac
gtcatcaaggacccgcctttcacccggatggatctggtcagttgccgtaacctgatgatc
tatctggaagccgacctgcaaggccgcctgatccccgcctttcactacgcgctcaggccc
ggcggcgtgctgttcctgtcgccgtccgagagcatcggcggccataccgagctgttttcg
cccttgaaccggaagtggaagttctaccggacagctccatccctcgcctcgacccgggcg
atgatggccagcggtctcgcctggaccaccgacgccacccgcagcccccccgtggaagtg
atgaccaagaccaaggacaccaacatcgccgaaatgacccgccgggcgctggtccagtcc
tttgccccggtctcggtgatgaccgacagcaagggggacattctctatgtccatggcgac
accagccgctatctgcgccccccgcccggacaggcgacgctgaacgccgtggagatggcc
catgaaggcttgcagctcgaaatgcggagcgcactgggccaggcggtcagtcacggcaca
ccgaccctggagcgggaggtgtcgttcatggtcggcgccgaggtccgccgagtccggctg
ggcgtcaggccgctgccggatcccgagcccggtctggggctggtgctgatcagcttccag
gatctgccggtctctgatcccggaaagccggcgcgccgtcgccgcgcccccagctccgcc
gaccgcgagcgcatcgaggaactggagcgcgatctggcctataccagggaaaacctccag
gccaccatcgaggagcagcaatcctccaacgaggagctgaaatccgccaacgaggaactg
caatccaccaacgaggaactgcaatccaccaacgaggagctggaaacctccaaggaggag
ctgcaatcggtcaacgaggagctgattaccgtcaacgccgaactgcaggccaagatcgag
caactggccggcatgcagaacgacatgaagaacctgctcgacaacatcaatgtcggcact
atcttcctcgacgaccgactggccatccgccgcttcacgcgcgaggcggccaaggtttac
cgtctggtcaccaccgacgtgggacgccccttggccgacatcaaatccgacctgggcggc
gacgatttgctggcccaggcgcagcaggtgatagacaccctgatcccctttgaacgggaa
gtgcgcaccatcggcggcgactggtatctcacccgtatccagccctaccgcaccctggac
aacgtcatcgacggcgtggtgatcaccttttccaacgtcactgcccgcgtcgccgccgag
caggccgagcaggaaggccacgacatcgccgagagcatcgtcgatgcggtggacaagccc
ctgctggtgctggacggcgccttctccgtcatctttgccagcaattcgttctatcgcgat
ttcaaggtctcacctggggaggcaagggggcggtcgatctattccctggactacatcgcg
tgggattcacctgcgctgaaggacctgctcgaaaacgtcctgccccgcaaacaaagtttc
tccgctttccccttggatagtcacaagatgcggcttggcggtcggcggatcgtttgcagg
acgagcggcaagcctctgatcctgctaaccttcgagaaggataccgcctga

DBGET integrated database retrieval system