KEGG   Magnetospirillum magneticum: amb3708Help
Entry
amb3708           CDS       T00305                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mag  Magnetospirillum magneticum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    amb3708
Enzymes [BR:mag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     amb3708
Transfer RNA biogenesis [BR:mag03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    amb3708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4076282..4077058
Genome map
AA seq 258 aa AA seqDB search
MTLPADLAPLLRPLEDLARRAGAVVMEVYNSDFAVRDKTDSSPVTEADERAEAIILPGLA
ALTPGVPVVAEESVAAGTIPAIGSGPFWLVDPVDGTKEFIKRNGEFTVNIGLIRDGVPVL
GVVLAPARGELWSGTGATAFKEDANGRRPIACRPLPASGAVIMTSRSHREPESLDKWMAQ
FPGATLGFAGSSLKFCLVAEGAADLYPRFGPTSEWDIAAASAVLMAAGGSVTTFDGLPMA
YGKTPKFLNPDFIARGRG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcccgccgatctcgcgcccctgcttcgccccctggaggacctggcccgccgg
gccggcgcggtggtgatggaggtctacaactccgacttcgccgtgcgcgacaagaccgat
tcctcgccggtcaccgaggccgacgagcgggccgaggccatcatcctgcccggcctcgcc
gccctgacccccggcgtgccggtggtggcagaggaatccgtggcggccgggaccatcccc
gccatcggctccggcccgttctggctggtggacccggtggacggcaccaaggaattcatc
aagcgcaacggcgagttcaccgtcaatatcggcctgatccgggacggcgttccggtgctg
ggcgtggtgctggccccggcacgcggcgagttgtggtcgggcaccggcgccaccgccttc
aaggaagatgcgaacggccgccgccccatcgcctgccgcccgctccccgcgtcgggcgcc
gtgatcatgacgtcgcgctcccaccgcgagcccgagtccctggacaaatggatggcgcag
ttccccggggccaccctgggcttcgccggctcgtccttgaagttctgcctggtggccgag
ggcgccgccgacctctatccccgctttggccccaccagcgaatgggacatcgcggcggcc
agcgccgtgctgatggcggcaggcggcagcgtcaccacctttgacggccttcccatggcc
tatggcaaaacacccaagttcctcaaccccgacttcattgcccgcggacgagggtaa

DBGET integrated database retrieval system