KEGG   Magnetospirillum magneticum: amb3843Help
Entry
amb3843           CDS       T00305                                 

Definition
(GenBank) UDP-N-acetylmuramyl tripeptide synthase
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mag  Magnetospirillum magneticum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    amb3843
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    amb3843
Enzymes [BR:mag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     amb3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4241853..4243289
Genome map
AA seq 478 aa AA seqDB search
MTATAPARDVTITGLTADSRAVRPGYLFAALPGTKADGRAFIPAALAAGAVAVLAPEGSR
PDLPPEVVLVTDANPRRRFALMASAFHGAQPRVMTAVTGTNGKTSTAEFFRQIMARLGHA
AAAIGTLGITAPGWDNQGGLTTPDPAGLHADLARLAEMGVTHACMEASSHGLDQHRLDGV
RLMAAAFTNLTRDHLDYHADMNAYAEAKLRLFAEVLPEGATAVINADSDLAPRAVELCAK
RGITVLGFGRTARDLRLIEARPTAAGQELDLEIMGRAVTIRLPLAGRFQADNALAALGLA
LACGADPVAALEALGHLDGVPGRLQQVASRANGAPIYVDYAHTPDALETVLKALRPHAAR
RLVAVFGCGGDRDAGKRPLMGAIGCRLADAMIVTDDNPRSEDPAAIRAAVRGACPAGIEI
ADRRGAIRAAVSGLQKGDVLVIAGKGHEQGQIVGASVLPFDDAAEARDAVRLADGDAS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacagcgcccgcccgcgatgtgaccatcaccggcctgaccgccgattcccgc
gcggtcaggccgggctatctttttgccgccctgcccggaaccaaggccgacgggcgggcg
ttcatccccgccgcgctcgccgccggcgccgtggccgtgctggcccccgagggctcgcgc
cccgacctgccgcccgaggtggtgctagtcaccgatgccaatccccgccgccgcttcgcc
ctgatggcctcggccttccacggcgcccagccccgggtgatgaccgccgtcaccggcacc
aacggcaagacctccaccgccgagttcttccgccagatcatggcccgcctgggccacgcc
gccgccgccatcggcaccctgggcatcaccgcgccgggctgggacaaccagggcggactg
accacccccgaccccgccgggctgcacgccgatctcgcccggctggccgaaatgggcgtc
acccatgcctgcatggaggcgtccagccacggcctggaccagcaccgcctggacggcgtc
cggctgatggccgccgccttcaccaacctgacccgcgatcatctcgactaccacgccgac
atgaacgcctatgccgaggccaagctgcggctgttcgccgaagtgctgcccgagggcgcc
accgcggtgatcaacgccgattccgatctggcgccccgcgccgtcgagctgtgcgccaaa
cgcggcatcaccgtgctgggcttcggccggaccgcccgcgacctgcggctgatcgaagcc
cggcccaccgccgccggccaggagttggacctggagatcatgggccgcgccgtgaccatc
cgcctgccgctggccggacgcttccaggccgacaacgccctggccgccctggggctggcc
ctggcctgcggcgccgacccggtggcggcactcgaggcgctgggacacctggacggcgtg
cccggccgcctgcagcaggtggccagccgcgccaacggcgccccgatctatgtggattac
gcccacacccccgacgcgctggagacggtgctgaaggccctgcgtccccatgccgcccgc
cgtctggtggcggtgttcggctgcggcggcgatcgcgatgccggcaagcgccccctgatg
ggcgccatcggctgccgtctggccgacgccatgatcgtcaccgacgacaacccccgctcg
gaagacccggccgccatccgcgccgccgtgcgcggcgcctgccccgccggcatcgagatc
gccgaccgccgcggcgccatccgcgccgccgtgtcgggcctgcagaagggcgacgtcctg
gtcatcgccggcaagggccacgagcagggccagatcgtcggcgcctccgtgctgcccttc
gacgatgccgccgaagcccgcgacgccgtccgtctcgccgatggagacgcctcatga

DBGET integrated database retrieval system