KEGG   Magnetospirillum magneticum: amb3951Help
Entry
amb3951           CDS       T00305                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mag  Magnetospirillum magneticum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amb3951
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amb3951
   00650 Butanoate metabolism
    amb3951
  Energy metabolism
   00190 Oxidative phosphorylation
    amb3951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4359755..4360135
Genome map
AA seq 126 aa AA seqDB search
MSLESPVGRARGLGSAKEGAGHWIAQRVTAIFLIPLSLWFAVSVIGLSHADYATFKAWMA
KPGNSSLLLLTVLTVLYHAQLGLQVVIEDYVSCECKKIAALVGSKLIIAFLAVFMTVSIL
KVAIGA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgaatcccctgtcggccgcgcccgcggcctcggttccgccaaggaaggcgcc
ggccactggatcgcccagcgcgtcaccgccatcttcctgatccccctgtcgctgtggttc
gccgtctccgtgatcggcctgtcgcacgcagactacgccaccttcaaggcgtggatggcc
aagcccggcaattcctcgctgctgctgctgaccgtgctgaccgtgctgtaccacgcccag
ctgggcctgcaggtggtgatcgaggactacgtcagctgcgagtgcaagaagatcgcggcc
ctggtcgggtccaagctgatcatcgccttcctcgccgtcttcatgacggtgtcgatcctc
aaagtcgcgattggagcctga

DBGET integrated database retrieval system