KEGG   Magnetospirillum magneticum: amb3962Help
Entry
amb3962           CDS       T00305                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mag  Magnetospirillum magneticum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:mag01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mag00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mag00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4372060..4373244
Genome map
AA seq 394 aa AA seqDB search
MTTEIKVPTLGESVTEATIAKWFKNVGDAVRADEPLVELETDKVTVEVNAPAAGTLTDIV
AAAGATVEVGALLGVLGAAGAAAAPAPKAAAPAPAAAPAAAGVMPSAKKIAADAGIDTAA
ISGTGKDGRVTKGDVLAAAAAPAPAAPAPKPAAPSGPRAKADQEERVKMTRLRKTIAGRL
KEAQNTAAMLTTFNEVDMTALFDVRNQYKDQFEKRHGTKLGFMSFFVKACVAALKDWPAV
NAEIDGDDLVYKKYYDIGVAVGTPQGLVVPVLRGADQLSFAGVEQGIANLGKKARDGKLS
MEDLMGGTFTISNGGVYGSLMSTPILNTPQSGILGMHKVQQRPMVMPDGSIKARPMMYLA
LSYDHRIIDGREAVSFLVRVKECIEDPQRILLEM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaaatcaaggtgcccaccctgggcgagtccgtgaccgaagccaccatcgcc
aagtggttcaagaatgtgggcgatgccgtccgcgccgatgagcccctggtcgaactggaa
accgacaaggtcaccgtcgaggtcaacgcgcccgccgccggcacgctgaccgacatcgtc
gccgccgccggcgccaccgtggaagtgggtgccctgctgggcgtcctgggcgccgccggt
gccgccgccgccccggcccccaaggccgccgctccggctccggccgccgccccggccgcc
gcgggcgtcatgccctcggccaaaaagatcgccgccgatgccggcatcgacaccgccgcc
atcagcggcaccggcaaggacgggcgggtgaccaagggtgacgtgctggccgccgccgcc
gctccggctccggccgccccggcccccaagcccgccgccccctcgggcccgcgtgccaag
gccgaccaggaagagcgggtcaagatgacccgcctgcgcaagaccatcgccggccgcctg
aaggaggcccagaacaccgccgccatgctgaccaccttcaacgaggtggacatgacggcg
ctgttcgacgtcaggaaccagtacaaggaccagttcgagaagcgccacggcaccaagctg
ggcttcatgtccttcttcgtgaaggcctgcgtcgccgcgctcaaggattggccggcggtc
aatgccgagatcgacggcgacgatctggtctacaagaagtactacgacatcggcgtggcc
gtgggcaccccccagggcctggtggtaccggtgctgcgcggggccgaccagctgtccttc
gccggcgtcgagcagggcatcgccaacctgggcaagaaggcccgcgatggcaagctgtcc
atggaagacctgatgggcggcaccttcaccatctccaacggcggcgtctatggctcgctg
atgagcacccccatcctcaataccccccagtcgggtatcctggggatgcacaaggtgcag
cagcgccccatggtcatgcccgacggctccatcaaggcgcgccccatgatgtatctggcg
ctctcctacgaccaccgcatcatcgacggccgcgaggcggtgtcgttcctggtgcgcgtc
aaggagtgcatcgaggacccgcagcgcatcctgctggagatgtaa

DBGET integrated database retrieval system