KEGG   Magnetospirillum magneticum: amb4010Help
Entry
amb4010           CDS       T00305                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    amb4010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amb4010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    amb4010
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     amb4010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4417044..4418195
Genome map
AA seq 383 aa AA seqDB search
MAETLMPLILEVEKAYAAAKADPAFQAEFRRLLSQYVGRPNPLYFAPRLTQAFGGAKVFL
KREDLNHTGAHKINNCIGQILLARRMGKQRIIAETGAGQHGVATATVCALFGMQCVIYMG
STDIERQMPNVYRMKLLGAEVRPVTSGAATLKDAMNDALRDWVSNVADTYYLIGTVAGPH
PYPAMVRDFQSVIGEEAREQMQAQEGRLPDSLVACIGGGSNAMGLFHPFLDDSSVRIIGV
EAAGHGLDKLHAASLTGGKPGVLHGNRTYLLQDADGQIAEAHSISAGLDYPGIGPEHSWL
HESGRVEYVSVTDDEAVAAFQQCTRLEGIIPALESSHAIAYASKIAPALPKDHLMVVNLS
GRGDKDVSTIAKALGDEHLGGLV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtggccgaaaccctgatgcccctcattctcgaggtggagaaggcctacgccgcggccaag
gccgatccagccttccaggccgagttccgccggctgctgtcccaatacgtgggacgcccc
aatccgctgtacttcgcgccgcgcctgacccaggccttcggcggcgccaaggtgttcctg
aagcgcgaggacctcaaccacaccggcgcccacaagatcaacaactgcatcggccagatc
ctgctggcccggcgcatgggcaagcagcgcatcatcgccgagaccggggccggccagcac
ggcgtggccaccgccaccgtctgcgccctgttcggcatgcaatgcgtcatctacatgggc
tccaccgacatcgagcggcagatgcccaacgtctaccgcatgaagctgctgggcgccgag
gtccgtccggtcaccagcggcgccgcgaccctcaaggacgccatgaacgacgcgttgcgc
gactgggtctccaacgtcgccgacacctattacctgatcggcacggtggccgggccgcac
ccctaccccgccatggtccgcgacttccagtcggtgatcggcgaggaagcgcgcgagcag
atgcaggcccaggaaggccgcctgcccgattcgctggtggcctgcatcggcggcggctcc
aacgccatgggcctgttccatcccttcctcgacgacagcagcgtgcgcatcatcggcgtc
gaagcggccggtcacggcctggacaagctgcacgccgccagcctgaccggcggcaagccg
ggggtgctgcacggcaaccgcacctatctgctgcaggatgccgacggccagatcgccgag
gcccattccatctcggcaggcctcgactatcccggtatcgggcccgaacattcctggctg
cacgaaagcggccgggtggaatacgtctcggtcaccgatgacgaggccgtggccgccttc
cagcaatgcacccgcctggagggcatcattccggcgctggaatccagccacgccatcgcc
tacgcctcgaagatcgcccccgccctgcccaaggaccacctgatggtggtcaacctgtcc
ggacgcggcgacaaggacgtcagcaccatcgccaaggcgctgggcgacgagcacctggga
ggactcgtctga

DBGET integrated database retrieval system