KEGG   Magnetospirillum magneticum: amb4011Help
Entry
amb4011           CDS       T00305                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mag  Magnetospirillum magneticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    amb4011
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amb4011
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    amb4011
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     amb4011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4418195..4419004
Genome map
AA seq 269 aa AA seqDB search
MSRIAKRFAKLKAENRAALVTFITAGDPDHATSQALLDGMPAAGADIIELGMPFTDPMAD
GPAIQLAAGRALAAGGSLRQTLEMVEAFRKTDAETPIILMGYYNPVYAWGAEKFAADAAK
AGVDGLIIVDLPPEEADELVPFLRQAGIDFIVLTTPTSDDARLPVVLANASGFVYYVSIA
GITGTASAAQSAIDEAVARIRRHTGLPVCVGFGIKDPAQAAEVARVADGAVVGSAIVSVL
ADNIGKPGAVSAPLALVKDLAAGVRGARN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcattgccaagcgtttcgccaagctcaaggccgagaaccgcgccgccctggtg
accttcatcaccgccggcgaccccgaccacgccaccagccaggccctgctcgacggcatg
ccggcggcgggcgccgacatcatcgagctgggcatgcccttcaccgatcccatggccgac
ggccccgctatccagctggcggcgggccgcgccctggcggcgggcggatcgctccgccag
acgctggagatggtcgaagccttccgcaagaccgatgccgagacgccgatcatcctgatg
ggctactacaatcccgtctatgcctggggtgcggagaaattcgccgccgacgccgccaag
gccggagtggacgggctgatcatcgtcgacctgccgcccgaggaggccgacgaactggtg
ccgttcctgcgccaggccggcatcgacttcatcgtgctgaccacccccaccagcgatgac
gcccgcctgcccgtggtgctggccaatgcatcgggcttcgtctactacgtgtccatcgcc
ggcatcaccggcaccgcctcggcggcccaatcggccatcgacgaggcggtcgcccgcatc
cgccgccataccggcctgccggtctgcgtcggcttcggcatcaaggaccccgcccaggcg
gccgaagtggcacgcgtcgccgacggcgcggtggtgggctcggccatcgtttcggtgctg
gccgacaatatcggaaagcccggcgccgtttccgccccgctggccctggtcaaagacctg
gccgccggtgtgcgcggcgcccggaactag

DBGET integrated database retrieval system