KEGG   Magnetospirillum magneticum: amb4105Help
Entry
amb4105           CDS       T00305                                 

Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
mag  Magnetospirillum magneticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    amb4105
DNA repair and recombination proteins [BR:mag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      amb4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4508991..4509584
Genome map
AA seq 197 aa AA seqDB search
MVGPEIERLIQLLSRLPGLGPRSARRAALRLVEKRESLLVPLAQAMADAAARVRTCSVCG
NFDTIDPCAICADHRRDPSMLCVVEDVAGLWAMERTGSFKGRYAVLGGLLSALDGVGPED
LGIESLVARALDPAITEIILATPATVEGQTTAHYVAERLAPCNVTVSGLAHGVPVGGELD
HLDDGTITAALRARRVF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccccgagatcgagcgcctgatacaactcctttcgcggttgcccgggctgggg
ccgcgctcggcccggcgcgccgcgctgcgcctggtggaaaagcgggaaagcctgctggtc
ccgctcgcccaggccatggccgacgccgccgccagggtgcgcacctgctcggtctgcggc
aatttcgacaccatcgatccttgcgccatctgcgccgatcaccggcgcgatccctccatg
ctctgcgtggtcgaggacgtggccgggctgtgggccatggagcgcaccggcagcttcaag
gggcgctacgccgtcctcggcggcctgctctcggccctggatggcgtcgggccggaggat
ctgggcatcgagtccctggtggcccgcgccctcgatcccgccatcaccgagatcatcctg
gccacccccgccacggtggagggccagaccaccgcccattacgtggccgagcgcctggcc
ccgtgcaacgtcaccgtctcgggcctcgcccatggcgtgccggtgggcggcgagctggac
catctggacgacggcaccatcaccgccgcgctgcgggcccggcgggtgttctga

DBGET integrated database retrieval system