KEGG   Magnetospirillum magneticum: amb4105Help
Entry
amb4105           CDS       T00305                                 

Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
mag  Magnetospirillum magneticum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4508991..4509584
Genome map
AA seq 197 aa AA seqDB search
MVGPEIERLIQLLSRLPGLGPRSARRAALRLVEKRESLLVPLAQAMADAAARVRTCSVCG
NFDTIDPCAICADHRRDPSMLCVVEDVAGLWAMERTGSFKGRYAVLGGLLSALDGVGPED
LGIESLVARALDPAITEIILATPATVEGQTTAHYVAERLAPCNVTVSGLAHGVPVGGELD
HLDDGTITAALRARRVF
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccccgagatcgagcgcctgatacaactcctttcgcggttgcccgggctgggg
ccgcgctcggcccggcgcgccgcgctgcgcctggtggaaaagcgggaaagcctgctggtc
ccgctcgcccaggccatggccgacgccgccgccagggtgcgcacctgctcggtctgcggc
aatttcgacaccatcgatccttgcgccatctgcgccgatcaccggcgcgatccctccatg
ctctgcgtggtcgaggacgtggccgggctgtgggccatggagcgcaccggcagcttcaag
gggcgctacgccgtcctcggcggcctgctctcggccctggatggcgtcgggccggaggat
ctgggcatcgagtccctggtggcccgcgccctcgatcccgccatcaccgagatcatcctg
gccacccccgccacggtggagggccagaccaccgcccattacgtggccgagcgcctggcc
ccgtgcaacgtcaccgtctcgggcctcgcccatggcgtgccggtgggcggcgagctggac
catctggacgacggcaccatcaccgccgcgctgcgggcccggcgggtgttctga

DBGET integrated database retrieval system