KEGG   Magnetospirillum magneticum: amb4327Help
Entry
amb4327           CDS       T00305                                 

Definition
lysophospholipase L1 and related esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mag  Magnetospirillum magneticum
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    amb4327
Enzymes [BR:mag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     amb4327
   3.1.2  Thioester hydrolases
    3.1.2.-  
     amb4327
Lipid biosynthesis proteins [BR:mag01004]
 Fatty acid synthase
  Component type
   amb4327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4733553..4734668
Genome map
AA seq 371 aa AA seqDB search
MRQPHPAQFLLRRAEGIGMTGQFQGYRHVLQRRHGGNQMKALKDDADTVAAKARQPVLIH
GAEILARHRHLARGGALQTGHHHQQGGLARARGTDHAQGLARRHLQVDAIENIDLARKAR
QVEMDGLQRNQGKAGDGALMHARATFLNGRGVLTSINRDRRAVLRYGAAALLVNALGGGA
MAGTASGRRILALGDSLTAGYGLAPEEAFPAQLERVLRAEGRDVTVINAGVSGDTTAGGK
ARLDWALGAKPHLAILELGANDGLRGLDPKLTHANLDAILKRLTAAGIPVLLAGMLAPPN
YGKAFEAEFKAVFARLAAEHDVVFYPFFLDGVAGDRGLCLPDGLHPNAKGVGVIVGRILP
SVRRLLERGTP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccagccccacccggcccagttcctcctgcgccgcgccgaagggatcggcatgacc
ggccagttccaggggtaccgccacgttctccagcgccgtcatggtgggaatcagatgaaa
gctctgaaagacgatgccgatactgtcgcggcgaaagcgcgccagcccgtcctcatccat
ggggccgaaatcctggcccgccaccgccaccttgcccgaggtggggcgctccagaccggc
catcaccatcagcagggtggacttgcccgagcccgagggaccgaccacgcccagggtctc
gcccgacgccacctgcaggtcgatgccatcgagaacattgacctcgcccgcaaggctcgc
caagttgagatggacggcctccagcgaaaccaggggaaggccggcgatggggcgctgatg
catgcgagggcgactttcttgaacggacggggcgtcttgaccagcataaaccgggacaga
cgggcggtcttgcgatatggggccgcggcgctgcttgtcaatgcgctgggaggtggcgcc
atggccggaacggcgagcggacgacgcattctggccctgggggattcgctgaccgccggc
tatggcctggcgcccgaggaggcctttcccgcccagctggaacgggtgctgcgcgccgag
gggcgcgacgtcaccgtgatcaatgccggtgtctccggcgacaccacggcggggggcaag
gcccgcctggactgggcgctgggcgccaagccccacctcgccatcctggaactgggcgcc
aatgacggattgcgcggcctcgaccccaagctgacccacgccaatctcgacgccatcctg
aagcgactgacggcggcgggcattcccgtgctgctggccggcatgctggcgccgcccaat
tacggcaaggccttcgaggccgagttcaaggcggtcttcgcccgcctcgccgccgagcac
gacgtggtcttctatcccttcttcctggatggggtggccggcgaccgcggcctgtgcctg
cccgacggactgcatcccaatgccaagggcgtcggcgtgatcgtcgggcgcatcctgccc
tcggtgcgccgattgctggaaaggggaacgccatga

DBGET integrated database retrieval system