KEGG   Magnetospirillum magneticum: amb4421Help
Entry
amb4421           CDS       T00305                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mag  Magnetospirillum magneticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    amb4421
Enzymes [BR:mag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     amb4421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4827920..4828648
Genome map
AA seq 242 aa AA seqDB search
MRALVTRPKEDSEGVAQALKQRGLDVMVEPLLDIAPVEGAKPDLGGAQGILVTSANGIRA
LGRLTPGRELPVWAVGDASARAAREMGFTRVESAGGDVETLAELVAARVDPQGGALLHAA
GTVTAGDLSGRLSALGFQVRRQVLYRAVTATRLSDGLRDALRNGQLHLALFFSPRTARTF
ATLAVEAGVRDSLAAIAAYGLSANVSAELGPLPWRVLRQAAEPTQAALLAAIDDDLNRGF
SP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccctcgtcacgcgaccgaaggaggattccgagggcgtggcgcaggcactgaag
cagcgcggcctcgacgtcatggtcgagccgctgctcgacatcgccccggtggagggcgcc
aagcccgatctcggcggcgcccagggcatcctggtgaccagtgccaacggcattcgcgcc
ctgggccgcctcacccccggccgggagcttcccgtctgggccgtgggcgacgcctcggcc
cgcgccgcgcgcgaaatggggttcacccgcgtggaaagcgccggtggcgacgtggagacc
ctggccgagctggtggcggcccgcgtcgacccccagggcggcgccctgctgcatgccgcc
ggaacggtgacggccggggatctgtcggggcgcttgtcggcgctgggattccaggtgcgg
cggcaggtcctttatcgggcggtgaccgccacccgcctgtccgacgggctgcgggacgcg
ctgcggaacggccaactgcatctggctctgtttttctctccccgcaccgccaggaccttt
gctaccttggcggttgaggcgggggtgcgggacagtctcgccgccatcgccgcctatggc
ctgtcggccaatgtctcggccgagcttggcccgctgccctggcgggtgctgcgccaggcc
gccgaacctacccaggcggctctgctggccgccatcgacgacgacctcaaccggggattc
agcccatga

DBGET integrated database retrieval system