KEGG   Magnetospirillum magneticum: amb4451Help
Entry
amb4451           CDS       T00305                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mag  Magnetospirillum magneticum
Pathway
mag00040  Pentose and glucuronate interconversions
mag00052  Galactose metabolism
mag00500  Starch and sucrose metabolism
mag00520  Amino sugar and nucleotide sugar metabolism
mag01100  Metabolic pathways
mag01130  Biosynthesis of antibiotics
Module
mag_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    amb4451
   00052 Galactose metabolism
    amb4451
   00500 Starch and sucrose metabolism
    amb4451
   00520 Amino sugar and nucleotide sugar metabolism
    amb4451
Enzymes [BR:mag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     amb4451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: BAE53255
UniProt: Q2VYS0
Position
4864574..4865449
Genome map
AA seq 291 aa AA seqDB search
MIRKAVLPVAGMGTRVLPATKVLPKELLPVVDKPLIQYAVEEAAEAGITEIVLVTARGKE
MLADHFDRNAELERSLETRGKTELLDIARSTCPKGVSITTVRQPAPLGLGHAVLCARPVI
GDEPFAVLLPDDLILGAPGCLKQLVDVWNETRGHVIAVENVPADQVDRYGILDVIEEKGR
LARARGLVEKPKPSEAPSTLSVIGRYVLDASVFDALERRERGAGGEIQLTDAIARTLGSV
PLHGARFHGTRYDCGNKAGYVAAIIDAALAHPETAAAVLAHLEALSGRRAA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcaaagccgttcttcccgtcgccggcatgggcacccgcgttctgcccgccacc
aaggtgctgcccaaggaattgctgccggtggtggacaagccgctgatccagtacgcggtg
gaggaagccgccgaggcgggcatcaccgagatcgtcctggtcaccgcccggggcaaggag
atgctggccgaccatttcgaccgcaacgccgagctggagcgttcgctggagacgcgcggc
aagaccgagctgctggacatcgcccgcagcacctgccccaagggggtgagcatcaccacc
gtgcgccagccggcgccgctgggtctgggccatgccgtgctgtgcgcccgcccggtgatc
ggtgacgagcccttcgccgtgctgttgcccgacgacctgatcctgggggcgcccggctgc
ctgaaacagctggtcgacgtgtggaacgagacccgcggccatgtgatcgccgtggagaac
gtgcccgccgaccaggtggaccgctacggcatcctggacgtgatcgaggagaagggccgt
ctggcccgcgcccgtggcctggtggaaaagcccaagccgtccgaggcgccctcgaccctg
tcagtgatcggccgctatgtgctggacgccagcgtgttcgacgccctggagcggcgtgag
aggggtgccggcggcgagatccagctgaccgacgccatcgcccgcaccctgggcagcgtg
ccgctgcacggcgcccgcttccacggcacccgctacgactgcggcaataaggcgggctat
gtggcggcgatcatcgacgccgccctggcccatccggaaactgccgccgccgtgctcgcc
catctcgaggcgctgtccggacgccgtgccgcctaa

DBGET integrated database retrieval system