KEGG   Methylomicrobium alcaliphilum: MEALZ_0085Help
Entry
MEALZ_0085        CDS       T01649                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mah00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95467..95982)
Genome map
AA seq 171 aa AA seqDB search
MARCYISIGSNIDRETNIPSSLRALKNHFGELIISSTYESEAVGFSGDNFYNLVVGFDTD
IDVKNVAKILKQIELEHGRVRDSKKFSARTLDLDLLLYDDLIIEDGRLQIPRKEIEQYAF
VLEPLAEIAPDSKHPISRLSYKELWKNLDKSNLKQARILPNWPLRNRDGIN
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgatgctacatcagcataggcagcaatatcgaccgggaaaccaatattccttca
agcctacgtgcgctcaaaaatcatttcggcgaactgatcatttccagcacttacgaatcg
gaagcggtcggcttcagcggcgataatttttataacctcgttgtggggttcgacaccgat
atcgatgtcaaaaacgtagccaagatactcaaacaaatcgaactagagcatggcagggtt
cgcgacagtaaaaaattttccgcgcgaacactagatcttgatttactgctatacgatgat
ctaattatcgaagatggtcgattacaaataccgcgtaaggaaatcgaacaatacgccttc
gtccttgaaccgctcgcagaaattgctccggacagcaaacatccgattagccgattatct
tataaagaattatggaaaaatctagataaaagcaatctcaaacaagcgcgcattctgcct
aattggcctcttagaaacagagatggaataaattaa

DBGET integrated database retrieval system