KEGG   Methylomicrobium alcaliphilum: MEALZ_0132Help
Entry
MEALZ_0132        CDS       T01649                                 

Definition
(GenBank) Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00010  Glycolysis / Gluconeogenesis
mah00030  Pentose phosphate pathway
mah00051  Fructose and mannose metabolism
mah00052  Galactose metabolism
mah00230  Purine metabolism
mah00500  Starch and sucrose metabolism
mah00520  Amino sugar and nucleotide sugar metabolism
mah00521  Streptomycin biosynthesis
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01120  Microbial metabolism in diverse environments
mah01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_0132
   00030 Pentose phosphate pathway
    MEALZ_0132
   00051 Fructose and mannose metabolism
    MEALZ_0132
   00052 Galactose metabolism
    MEALZ_0132
   00500 Starch and sucrose metabolism
    MEALZ_0132
   00520 Amino sugar and nucleotide sugar metabolism
    MEALZ_0132
  Nucleotide metabolism
   00230 Purine metabolism
    MEALZ_0132
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MEALZ_0132
Enzymes [BR:mah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MEALZ_0132
    5.4.2.8  phosphomannomutase
     MEALZ_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV dCache_1 DUF5300
Motif
Other DBs
NCBI-ProteinID: CCE21833
UniProt: G4SUK7
Position
147932..150472
Genome map
AA seq 846 aa AA seqDB search
MERIFLPLSIIAAFVVLLTGGAIYWANDSSIKEAKHDSAMALAAGTALGISKQIEQLASA
IDKMARDPTVIEAMENRDRGRIRALEAQLEKYLPGALKIRLLLPGINDLDTEHVPHMGFA
DLDMVKETFSGNPQPLIQGEGANRHLAITARIEESGRVAGVILASLSYDFINNSIKPSSI
GNQLIQLRQGDFELAAVGNRALIGDAASVQMPIAHTAWQVQVWYQIGGSSSDVGLIAAIM
LIAVLLVCLAFFVGYRKSANILSHDQSIVLKAVKDLMTGNAYGNYPVNLSEMSVIISTLV
QFKRVLDHQGDDVVAIANESEADFDGFFEESDFAIEEIVENAKAGDAETSPVSMPDVDWD
MPIPEAKPTPVPEQPKPSPISKATAPLHEGSGEVFRAYDIRGVVGKTLTTELAYDIGRAF
GTEVRKADCNIVVVGRDGRHSSPELADAVINGIVSTGRDVLDLGMVPTPILYFVTQHTEG
RTGLMITGSHNPAEYNGMKMVIKGETLAGQRVAKLKNIIDKQDYAVEVGGTVDQNSMFVN
EYIGIVAEDVHLVRPMKIVLDCGNGVAGDIAPILFKTLGCEVVELFCDVDGSFPNHHPDP
SVPENLEDLIAAVQHYEADIGIAFDGDGDRLGVVDSNGKIIWPDRLMMLFAKDVLARKPG
AQIVYDVKCSRHLAEQIAKYGGRALMWKTGHSYMKAKVKETGAKLAGEMSGHIFFNDRWY
GFDDALYSAARLIEILSSDARTSAEIFAEFPESLNTPELLVSMKEGENFDFIERLFAKAD
FKDGKITNIDGLRVDFSDGWGLVRASNTTPSLVVRFEADSEQAMRRIQKEFKTLIASIEP
QLVLPF
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtatattcttaccgctgtcgatcattgcggcatttgtggtgctattgacagga
ggagcgatttattgggctaatgactccagcatcaaggaagctaagcatgattcagcaatg
gctctggctgccggtaccgcattaggtatttcaaaacaaatcgaacaattggctagcgca
attgacaaaatggctcgagatccgactgtaatagaggcaatggaaaacagagacaggggc
cggattcgagcgttagaagcacaattggaaaaatatttgccgggcgcattaaagatcaga
ttattgctgccaggcataaacgatttggataccgaacatgttccgcacatgggctttgcc
gatttggacatggttaaggaaacctttagcgggaatcctcaacccttgattcaaggggag
ggtgctaaccggcatcttgcgataacggctagaattgaagaaagcggccgcgtggcgggt
gtcatattggccagtttgagttatgactttattaataacagcattaagcctagctctatc
ggcaatcagttgattcaattgaggcagggtgacttcgagttggcagcggttggaaaccga
gcgcttatcggcgatgctgctagtgtgcagatgcctattgctcacacggcatggcaagtt
caggtttggtatcagataggggggagctcttcggatgtagggttgattgcggcaattatg
ttaatagcggtgctgttggtttgtcttgcgttttttgtaggctatcggaaaagtgccaat
attttaagccacgaccaaagtattgttttaaaagccgtcaaggatctaatgaccggaaat
gcgtatggtaattatccggtaaatttgagtgagatgagtgtcattatttccacgctggta
caattcaagcgagtattggatcatcaaggagacgacgtcgttgcgattgctaatgaaagc
gaagccgattttgacggattttttgaagaatccgattttgcgattgaagaaattgttgaa
aacgctaaagcaggcgatgccgaaacaagtccggtctcaatgccggatgtcgattgggat
atgccgataccagaagcgaaaccaactccggttcccgagcagccaaaaccctcccctatt
tcaaaagcgacggcaccgttgcacgaggggagcggagaagtatttagagcctatgatata
cggggcgtggtcggcaaaacgctgacaaccgaactggcttatgatattggccgcgcgttt
ggtacggaagtgagaaaagcggattgtaacattgtcgtggtcggacgtgatgggcgccat
tccagtcccgaattggcggatgccgtgatcaatggcattgtttcgacagggcgggatgtc
ctcgatttgggcatggtgccgacacctattctgtatttcgttacgcaacataccgaagga
cggaccgggttaatgattaccgggagtcataatccggcagaatacaacggcatgaaaatg
gtgattaagggtgaaaccttggcagggcagcgtgtcgcgaagcttaaaaacatcatcgat
aaacaagattatgccgttgaggtaggcggtacggtcgaccagaacagcatgtttgttaat
gaatacatcggtattgtcgccgaagatgtacatttggtcaggccgatgaaaatcgtgttg
gattgcgggaacggcgtggccggtgatattgcaccgatactatttaagacgctgggttgc
gaagtcgtcgaattgttttgcgatgtcgatggcagttttcctaatcaccatccggatcca
agcgttccggaaaatttggaagacttaattgctgcggtgcaacattatgaggcggacatc
ggcatcgctttcgacggtgatggcgaccgccttggggtggtcgattcaaacggtaaaatt
atatggccggatcggctgatgatgttgtttgctaaggatgtcttggcaagaaagcccggt
gcgcagattgtttacgatgtcaaatgctctaggcatttggccgagcagatcgccaaatac
ggcggtcgagccttaatgtggaaaaccggccactcttatatgaaggcaaaagtcaaagaa
accggtgctaaattagctggagagatgagcgggcatatcttttttaatgaccgatggtac
gggtttgatgacgctttatattcagcggcgcgtctaattgagattttgtcctcggatgcc
agaaccagtgccgaaatttttgccgagtttccggaaagccttaatacaccggaattgctc
gtttcaatgaaagagggcgaaaattttgactttattgaacggttatttgccaaggccgat
ttcaaagatgggaaaatcaccaacatcgatggattacgggtcgatttttccgatggttgg
gggctagttagagcatcgaataccacgccttcattagtggtccgtttcgaagccgatagc
gagcaagcgatgcgccgaattcaaaaggagttcaagacattgatcgcgagtatcgagcca
cagctagttttacctttttaa

DBGET integrated database retrieval system