KEGG   Methylomicrobium alcaliphilum: MEALZ_0132Help
Entry
MEALZ_0132        CDS       T01649                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_0132
   00030 Pentose phosphate pathway
    MEALZ_0132
   00051 Fructose and mannose metabolism
    MEALZ_0132
   00052 Galactose metabolism
    MEALZ_0132
   00500 Starch and sucrose metabolism
    MEALZ_0132
   00520 Amino sugar and nucleotide sugar metabolism
    MEALZ_0132
  Nucleotide metabolism
   00230 Purine metabolism
    MEALZ_0132
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MEALZ_0132
Enzymes [BR:mah01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MEALZ_0132
    5.4.2.8  phosphomannomutase
     MEALZ_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
147932..150472
Genome map
AA seq 846 aa AA seqDB search
MERIFLPLSIIAAFVVLLTGGAIYWANDSSIKEAKHDSAMALAAGTALGISKQIEQLASA
IDKMARDPTVIEAMENRDRGRIRALEAQLEKYLPGALKIRLLLPGINDLDTEHVPHMGFA
DLDMVKETFSGNPQPLIQGEGANRHLAITARIEESGRVAGVILASLSYDFINNSIKPSSI
GNQLIQLRQGDFELAAVGNRALIGDAASVQMPIAHTAWQVQVWYQIGGSSSDVGLIAAIM
LIAVLLVCLAFFVGYRKSANILSHDQSIVLKAVKDLMTGNAYGNYPVNLSEMSVIISTLV
QFKRVLDHQGDDVVAIANESEADFDGFFEESDFAIEEIVENAKAGDAETSPVSMPDVDWD
MPIPEAKPTPVPEQPKPSPISKATAPLHEGSGEVFRAYDIRGVVGKTLTTELAYDIGRAF
GTEVRKADCNIVVVGRDGRHSSPELADAVINGIVSTGRDVLDLGMVPTPILYFVTQHTEG
RTGLMITGSHNPAEYNGMKMVIKGETLAGQRVAKLKNIIDKQDYAVEVGGTVDQNSMFVN
EYIGIVAEDVHLVRPMKIVLDCGNGVAGDIAPILFKTLGCEVVELFCDVDGSFPNHHPDP
SVPENLEDLIAAVQHYEADIGIAFDGDGDRLGVVDSNGKIIWPDRLMMLFAKDVLARKPG
AQIVYDVKCSRHLAEQIAKYGGRALMWKTGHSYMKAKVKETGAKLAGEMSGHIFFNDRWY
GFDDALYSAARLIEILSSDARTSAEIFAEFPESLNTPELLVSMKEGENFDFIERLFAKAD
FKDGKITNIDGLRVDFSDGWGLVRASNTTPSLVVRFEADSEQAMRRIQKEFKTLIASIEP
QLVLPF
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtatattcttaccgctgtcgatcattgcggcatttgtggtgctattgacagga
ggagcgatttattgggctaatgactccagcatcaaggaagctaagcatgattcagcaatg
gctctggctgccggtaccgcattaggtatttcaaaacaaatcgaacaattggctagcgca
attgacaaaatggctcgagatccgactgtaatagaggcaatggaaaacagagacaggggc
cggattcgagcgttagaagcacaattggaaaaatatttgccgggcgcattaaagatcaga
ttattgctgccaggcataaacgatttggataccgaacatgttccgcacatgggctttgcc
gatttggacatggttaaggaaacctttagcgggaatcctcaacccttgattcaaggggag
ggtgctaaccggcatcttgcgataacggctagaattgaagaaagcggccgcgtggcgggt
gtcatattggccagtttgagttatgactttattaataacagcattaagcctagctctatc
ggcaatcagttgattcaattgaggcagggtgacttcgagttggcagcggttggaaaccga
gcgcttatcggcgatgctgctagtgtgcagatgcctattgctcacacggcatggcaagtt
caggtttggtatcagataggggggagctcttcggatgtagggttgattgcggcaattatg
ttaatagcggtgctgttggtttgtcttgcgttttttgtaggctatcggaaaagtgccaat
attttaagccacgaccaaagtattgttttaaaagccgtcaaggatctaatgaccggaaat
gcgtatggtaattatccggtaaatttgagtgagatgagtgtcattatttccacgctggta
caattcaagcgagtattggatcatcaaggagacgacgtcgttgcgattgctaatgaaagc
gaagccgattttgacggattttttgaagaatccgattttgcgattgaagaaattgttgaa
aacgctaaagcaggcgatgccgaaacaagtccggtctcaatgccggatgtcgattgggat
atgccgataccagaagcgaaaccaactccggttcccgagcagccaaaaccctcccctatt
tcaaaagcgacggcaccgttgcacgaggggagcggagaagtatttagagcctatgatata
cggggcgtggtcggcaaaacgctgacaaccgaactggcttatgatattggccgcgcgttt
ggtacggaagtgagaaaagcggattgtaacattgtcgtggtcggacgtgatgggcgccat
tccagtcccgaattggcggatgccgtgatcaatggcattgtttcgacagggcgggatgtc
ctcgatttgggcatggtgccgacacctattctgtatttcgttacgcaacataccgaagga
cggaccgggttaatgattaccgggagtcataatccggcagaatacaacggcatgaaaatg
gtgattaagggtgaaaccttggcagggcagcgtgtcgcgaagcttaaaaacatcatcgat
aaacaagattatgccgttgaggtaggcggtacggtcgaccagaacagcatgtttgttaat
gaatacatcggtattgtcgccgaagatgtacatttggtcaggccgatgaaaatcgtgttg
gattgcgggaacggcgtggccggtgatattgcaccgatactatttaagacgctgggttgc
gaagtcgtcgaattgttttgcgatgtcgatggcagttttcctaatcaccatccggatcca
agcgttccggaaaatttggaagacttaattgctgcggtgcaacattatgaggcggacatc
ggcatcgctttcgacggtgatggcgaccgccttggggtggtcgattcaaacggtaaaatt
atatggccggatcggctgatgatgttgtttgctaaggatgtcttggcaagaaagcccggt
gcgcagattgtttacgatgtcaaatgctctaggcatttggccgagcagatcgccaaatac
ggcggtcgagccttaatgtggaaaaccggccactcttatatgaaggcaaaagtcaaagaa
accggtgctaaattagctggagagatgagcgggcatatcttttttaatgaccgatggtac
gggtttgatgacgctttatattcagcggcgcgtctaattgagattttgtcctcggatgcc
agaaccagtgccgaaatttttgccgagtttccggaaagccttaatacaccggaattgctc
gtttcaatgaaagagggcgaaaattttgactttattgaacggttatttgccaaggccgat
ttcaaagatgggaaaatcaccaacatcgatggattacgggtcgatttttccgatggttgg
gggctagttagagcatcgaataccacgccttcattagtggtccgtttcgaagccgatagc
gagcaagcgatgcgccgaattcaaaaggagttcaagacattgatcgcgagtatcgagcca
cagctagttttacctttttaa

DBGET integrated database retrieval system