KEGG   Methylomicrobium alcaliphilum: MEALZ_0148Help
Entry
MEALZ_0148        CDS       T01649                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS)
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01130  Biosynthesis of antibiotics
mah01230  Biosynthesis of amino acids
Module
mah_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEALZ_0148 (trpC)
Enzymes [BR:mah01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MEALZ_0148 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: CCE21849
UniProt: G4SV73
Position
complement(164923..165726)
Genome map
AA seq 267 aa AA seqDB search
MTDTPDILKKILDTKADEIARRKLNTTVDMLREIAGGVESPRGFAAALQSKVAGKKTAII
AEVKKASPSKGVIRENFDPVAIGQDYAMNGAACLSVLTDKEYFQGSEVYLQMVRERCPLP
VLRKDFMIDPYQVFEARALGADCILLIVAALDDAQMHELANTAKELGMDVLVEVHDADEL
QRALTLDTPLIGINNRNLRTFETSLQTTLDLKDQIPENRIIITESGIHTPEDVKLMTDNA
IYAFLVGEAFMRAPSPGQKMRELFELP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatactcccgatattctaaaaaaaatccttgataccaaagccgacgaaatcgca
cgccgcaagctgaacacgacggtcgacatgctgcgtgaaatcgcaggcggcgtcgaaagc
ccgcgcggattcgccgccgcgctacagagcaaggttgccggaaaaaaaactgcgatcatc
gccgaagtcaaaaaagcctcgccgagcaaaggcgtgatccgcgaaaacttcgatccggtc
gcaatcggccaagattatgcgatgaacggcgccgcctgcctgtcggtcctgaccgataag
gaatatttccaaggcagcgaagtgtatctgcaaatggtcagggaacgctgcccgctgccg
gtgctgcgcaaggatttcatgatcgacccttaccaggtcttcgaagcgcgcgccttaggc
gccgattgtattttgctgatagtcgccgcgctcgacgatgcacaaatgcacgaattagcg
aacaccgcgaaggaattgggcatggacgttctagtcgaagtgcatgacgcagatgaattg
caacgcgcgctaacactcgacacgccgctgatcggcatcaacaaccgtaacttgagaacc
ttcgaaacctctctgcaaacgacgctggacttgaaagatcaaatccctgagaaccgcatt
atcattaccgaaagcggcattcacacgcctgaagacgtcaagctgatgaccgacaacgct
atctatgccttcctggtcggcgaagccttcatgcgcgcgccaagccccggacaaaaaatg
cgcgaattgtttgaattgccgtag

DBGET integrated database retrieval system