KEGG   Methylomicrobium alcaliphilum: MEALZ_0338Help
Entry
MEALZ_0338        CDS       T01649                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mah00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mah00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364723..366552
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRNVVPILIEGLKRLEYRGYDSAGLAIVEDGQLYRKREVGKVRGLEALIAQ
DAIQGNIGIAHTRWATHGKPSTANAHPHVCRDKVAVVHNGIIENHEQLRNNQKAVGYEFT
SETDTEVIVNEIYGALENTDNLLGAVKESIKKLEGAYALGVVAKDHPNTLIACRKGSPLV
IGVGIGEYFIASDVAALLPVTQRFMFLEDGDVAEITIDKVVIYDKDDNLVDRSIKESQLK
ADSVEKGLYRHYMLKEIYDQPWAISEALEGRFIDNRLQESAFGHNAGEVFDQIESIQILA
CGTSYHAGLVARYWFEKLAKVPCNIEVASEYRYRKPIVPPGTLVVTISQSGETADTLAAL
QEAKKLGAKYSLAICNVPESSLVRESDLVMMTRAGPEIGVASTKAFTTQLATLLLLVIAI
GRRFGLTKELENKISSELFSLPGKIEAVLQLDDKIKQLSEQFAEKQHALFLGRGTHYPIA
MEGALKLKEISYIHAEAYPAGELKHGPLALIDAEMPVITVAPNNSLLEKLKSNIQEVSAR
GGQLIVFMDETLAAENDVNVQIIKMPPVENEISPIIYTIPLQLLSYHVAVLKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggcgcaattgcgcaacgtaacgtagtgccgatattgatcgaaggc
ctcaagcgccttgaatatcgcggttacgattcggccggattggccattgtcgaagatggt
cagctttatcgcaagcgcgaggtcggcaaggttagaggcttagaagccttgattgctcag
gatgcgatacaaggtaatatcggtatcgctcatacgcggtgggcgacgcatggcaaaccg
agtaccgcgaatgctcatcctcatgtatgccgcgacaaggttgcagtcgtgcataacggc
atcatcgaaaatcatgagcaattgaggaataatcagaaagcagtcggttatgaatttacc
tccgaaaccgataccgaagtgatcgtcaacgaaatatatggcgcactggaaaacactgat
aatctgctcggcgcggtcaaggaatcgatcaaaaagctcgaaggcgcttatgcgttaggc
gtcgttgcaaaggatcacccgaataccttgatcgcttgtagaaaaggtagtccgctcgtg
attggagtcggcatcggcgaatattttatcgcctccgatgtcgccgcgttgctgccggtt
acgcaacgttttatgtttctcgaagacggcgatgttgccgaaattacgatcgataaagtc
gtcatttacgacaaggacgacaacctagtcgaccggtcgatcaaagaaagccagctcaag
gccgattcggtcgaaaaaggcctctatcgccattacatgctcaaggaaatctacgaccaa
ccttgggcgatttccgaggcgctcgaaggacgctttatcgataatcgccttcaagaaagc
gcgttcggccataatgccggcgaggtattcgatcagatcgaatcgatacagatacttgct
tgcgggacgagctatcatgccggtttggttgcccgctattggttcgagaaattagccaaa
gtgccttgtaatatcgaagtagccagcgaatatcgctaccgtaaaccgatcgtccccccc
ggcaccttggttgtgacgatttcgcaatccggcgaaaccgccgatactttggccgcattg
caagaagccaaaaagctcggtgcaaaatattccctcgcgatctgtaatgttccggaaagc
tcgctagtcagagaatccgacttagtgatgatgactcgtgcaggccctgaaatcggcgtc
gcatcgacgaaagccttcacgacgcaattggcgaccttgttgcttttagtcattgcgata
gggaggcgcttcggactgacgaaagagttggaaaacaaaatatcttcggagcttttcagt
ttgcccggaaaaatcgaagcggttctgcaattggacgacaagatcaaacaattgtccgag
cagttcgccgaaaaacagcatgctttatttttaggtcgcgggactcattatccgatcgcg
atggaaggtgcattgaagcttaaggagatttcctatattcacgccgaagcttatcctgcg
ggcgaattgaaacatgggccgttggccctgatcgatgccgaaatgccggtcatcactgtc
gcgccgaacaatagcctgcttgaaaaactcaaatcgaacatacaggaagtcagcgcccga
ggcggtcaattgatcgtgtttatggacgaaacattggcggccgaaaacgatgtcaacgtt
caaattattaaaatgccgccggttgaaaacgaaatatcgccgattatctataccattccg
ttgcaattgctgtcctatcatgtcgcggtcctaaaagggaccgatgtcgatcagccgaga
aatctggctaagtcggtaacggtcgaataa

DBGET integrated database retrieval system