KEGG   Methylomicrobium alcaliphilum: MEALZ_0361Help
Entry
MEALZ_0361        CDS       T01649                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase 2
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mah  Methylomicrobium alcaliphilum
Brite
Enzymes [BR:mah01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MEALZ_0361 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385554..386240
Genome map
AA seq 228 aa AA seqDB search
MKENIQQMLDDIEAEVRLTRHYIGKNALEERVIDAMREVPRHLFVPEESRHYAYANGPVS
IGLGQTISQPYIVALMTDLLAPKPSDTILEIGTGSGYQAAILSRLVKQVYTVEIVETLAD
KARERLAVYGYHNIEVRSGDGYMGWPEHGPYEGIVVTAAAPHVPQPLIDQLRNGARLVIP
VGLPFSYQELLVIEKDSQGQIDSRTVLGVSFVPFTGKHMESAHHQWSP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaaacattcagcagatgctcgatgatatcgaagccgaagtacgcttgacgcgg
cattatatcggtaagaatgccttggaagagcgggttatcgatgcgatgcgtgaagtcccg
aggcatttgttcgtgcccgaggagtctcggcattacgcctatgccaacggtccggtatcg
atcggtttaggacagacgatatcgcagccttacattgtcgcgctgatgaccgatttattg
gctcccaagccgagcgacacgatattggaaatcggtaccggctccggctaccaagcggct
atcttatctcggctggtcaaacaggtatatacggttgaaatcgtcgaaaccttggccgat
aaagcgagggaaagactagcggtatacggttatcataatatcgaagtccgtagcggcgac
ggatatatgggatggcccgaacacggcccctatgaaggcatcgttgttaccgcagccgcg
ccgcatgtccctcagcctttgatcgatcaattacggaatggcgcgcgcttggtgattcca
gtcggtcttccctttagctatcaggaattgctggtcatagaaaaagactcgcaaggccaa
atcgattcgcgtacggtattgggcgtcagttttgtgccctttacaggtaaacatatggaa
tcggcccatcatcaatggagtccgtaa

DBGET integrated database retrieval system