KEGG   Methylomicrobium alcaliphilum: MEALZ_0392Help
Entry
MEALZ_0392        CDS       T01649                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mah  Methylomicrobium alcaliphilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423708..425243
Genome map
AA seq 511 aa AA seqDB search
MAAWSRKDFDSEWKGKYFKLLEEQETADKQTQENEVLLCKTITRLTLAAKGLNHQLDPFL
MRIHKTVKSGLKSAQLKIELEGLTKFSFNIDDSGISAFDAALLFDYLLKLYSDDKTVKLL
KVLQQKFESGEFKTNDELFLALVNATEPQSIASSFAPSGHADKIKTEILSQQLLLLLEDI
EIPFEFEESTERLKARLQNQSSASSFKQLLNDYVSLLVKIKNHIQSEQKDIKDFLSELTE
QLTELGLQAIGANDANRQSQINRNELDRFVSTQMQELQDSSAKATTLEPLKQLIGTRIAL
INKEILHHRENEERARQKTERQLNELTDKIKRMESESSDLKLKLSIALDRALRDPLTGLG
NRMAYDNRLELEITRWNRHKSPLTLIIWDIDHFKNINDTLGHKAGDKTLKIIAKLLSENC
RHLDFLSRFGGEEFTMLLPETDQESALTLANKLRKIIEKTRFNSGSGFLTITLSCGISQF
REGDTAESIFDRADKALYKAKQMGRNRCMAG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttggtctaggaaagattttgatagcgaatggaaaggtaagtatttcaagttg
cttgaagagcaggaaactgccgacaagcaaacgcaagaaaacgaagtactgttatgtaaa
acaataacccgcctgactctagcggcgaaagggttgaatcatcaactcgacccttttttg
atgcggattcataaaacggttaaatccgggttgaagagtgcgcaattaaaaatagaactc
gaaggcttgaccaagttttcattcaatattgatgattccgggataagcgcttttgatgcc
gcgcttttgtttgattatttgctcaaattgtattccgatgacaagaccgtcaagctttta
aaggtattgcagcaaaaattcgaaagcggtgaatttaaaaccaacgatgagttgtttttg
gccttggttaatgcaactgagcctcaatctatagcgtcttccttcgctccatcgggtcac
gccgataaaatcaaaaccgagattctcagtcagcagcttctattattgttagaggatatt
gaaattccattcgagttcgaggaatcgaccgagcggttaaaagcgcgactgcaaaatcaa
tcttcggcttcttcgttcaagcaattattaaacgattatgtttctctgttagttaaaatt
aaaaatcatattcaatccgaacaaaaagatattaaggattttttgtccgagttaaccgag
caattaaccgagttaggcttgcaagcgatcggtgcgaatgacgcgaatcgacaatctcag
atcaaccgtaacgaactcgatcgctttgtttcgacgcaaatgcaggaattacaagacagc
tctgctaaagcaaccacattggaaccgcttaagcagttgatcggtacccgtattgctcta
atcaataaggagattttgcaccatcgggaaaatgaggaaagagcaaggcaaaaaaccgag
cgacagctgaatgaattgaccgataaaattaaacgcatggaaagcgaatcgagcgatctg
aaattaaaattatcgatagcccttgatagggcattacgcgaccctttgacagggctcggt
aatcggatggcttacgataatcgtctcgagctcgaaataactcgttggaataggcataaa
agcccattgacgctgatcatctgggatatcgatcattttaaaaatattaacgatacattg
ggccataaagccggcgacaaaacgttgaaaatcattgctaaattattgagtgaaaattgc
cgacacttggattttttgtcgcgcttcgggggggaggagtttacaatgttgcttcctgaa
accgatcaggagtcggcattgacgctggccaataagttacgaaaaattatcgaaaaaaca
cgtttcaactcaggtagcgggtttcttactattaccttgtcctgcggtattagtcaattc
cgagaaggcgacacggccgaatcgattttcgatcgggctgacaaggcgctttataaagcc
aagcaaatgggcagaaatcgttgcatggctggatga

DBGET integrated database retrieval system