KEGG   Methylomicrobium alcaliphilum: MEALZ_0676Help
Entry
MEALZ_0676        CDS       T01649                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mah00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mah00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mah03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mah03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mah03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738931..739359
Genome map
AA seq 142 aa AA seqDB search
MPDIGFYILASRSERDRQLFACKLTEKAYRSGRLCYLLTEDPQQSAMLDDLLWTFRPGSF
VPHQLYDGMAPDKANAVLIGHLGVPDDWRDVVINLSTRIPDNWMNSERILEILDDSEESK
GPGRIRYQQYRQAGLSVVTHKM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcccgatatcggtttttacatcttagcgtcccggtccgaacgcgataggcagttattc
gcttgtaaactgaccgaaaaagcctatcgtagcgggaggctttgctacttattgaccgaa
gacccccagcaaagcgcgatgcttgacgacctgctttggacattcagacccggcagcttt
gtgccgcatcagttatacgatggcatggcgcccgataaggccaatgccgtcctgatcggg
catcttggcgtgcccgacgattggcgcgatgtagtcatcaatctgtcgacacgcattccg
gataattggatgaatagcgaacgcatcctcgaaatattggacgatagcgaagaaagcaaa
ggccccggtcgaatacgctatcaacaataccgtcaagccgggctatccgtcgttacgcat
aaaatgtaa

DBGET integrated database retrieval system