KEGG   Methylomicrobium alcaliphilum: MEALZ_0701Help
Entry
MEALZ_0701        CDS       T01649                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEALZ_0701
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_0701
   00052 Galactose metabolism
    MEALZ_0701
   00500 Starch and sucrose metabolism
    MEALZ_0701
   00520 Amino sugar and nucleotide sugar metabolism
    MEALZ_0701
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MEALZ_0701
   00524 Butirosin and neomycin biosynthesis
    MEALZ_0701
Enzymes [BR:mah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MEALZ_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
778699..779682
Genome map
AA seq 327 aa AA seqDB search
MILAGDIGGTKTTLALLSKNEHGLITLQQEQTFSSVEFPEFDEVLDKFLPAGVKVDSACF
GVAGPVIEQRCEPTNLPWQLDAKALKKTLRTDRVRLLNDLEAMALGMLCLDEKDWVELNP
NAKSQAGNMAVIAAGTGLGEAILYWDGARHHPIATEGGHCDFAAQTVQQDQLSNFLRKKY
NGHVSFERLVSGMGFGNIYDFLVENRFAPACPAVPDCAYPSVYGCDRNAIISRLGINGED
PLCTETIRIFIELYGAEAGNLALKSFATGGVFIGGGIGPKIRSVLESGKFIEAFKAKGRF
SGFLDTVSVKLSLNPRTPLMGAISYFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgattctggcaggcgatatcggagggaccaaaacgaccttggcattattgagcaagaat
gaacacggcttgattacgttgcaacaagaacaaaccttcagcagcgttgaatttccagag
ttcgatgaggtattagataaattcttaccggcgggcgtgaaggtcgattcggcctgtttc
ggcgtcgcagggccggttattgagcagcgctgcgagccgaccaatctgccctggcaactc
gatgctaaggcactgaaaaaaaccttacgcaccgatcgagtacgcttattaaacgatttg
gaagcgatggcgctcggcatgctgtgtctggacgaaaaagattgggtggaattgaaccct
aacgccaaatcgcaagccggaaatatggccgtgattgcagcgggaacaggtctcggtgaa
gcaatattgtattgggacggagcgcgccatcatccgatagcgaccgagggcggtcattgc
gactttgccgcgcaaaccgttcagcaagatcagctctcgaactttctgagaaaaaaatat
aacgggcatgtgagtttcgaacggctcgtttcaggcatggggttcggcaatatttatgac
tttttggtcgaaaaccgtttcgctcctgcttgtccagcggttcctgactgtgcttatccg
agtgtctacggctgcgatcgtaatgcgattatttcaagattaggcatcaacggcgaagat
cccttatgtaccgaaaccatccggatttttatagagctttacggtgccgaagccggtaat
ctggccttgaagtcattcgcgaccggcggggtttttatcgggggaggcattggtccaaaa
attcgatcggtattggagtcgggcaagtttatcgaagcatttaaagccaagggccgtttc
agcggttttctagataccgtgtcggtaaaattatcgctgaatccgcgtaccccgctgatg
ggggcgatcagttatttcggctga

DBGET integrated database retrieval system