KEGG   Methylomicrobium alcaliphilum: MEALZ_0891Help
Entry
MEALZ_0891        CDS       T01649                                 

Definition
hypothetical protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mah02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mah02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
994062..998588
Genome map
AA seq 1508 aa AA seqDB search
MSGSSVLCCPESEISSAQSHIVGIGASAGGLEALSAFVGNIPEGLGCVYIIAQHMSPNHR
SMMVDILSRESTLPVQTVVDGGLPEPENIYVVPPGFNLSIREGVFRLQPPLPEISPKPSV
NLLFQSMAEYYDERAVGIILSGTGSDGTSGLRAVKAAGGITFAQLPESAKYDGMPRSAIE
SGVVDRIMMPDQMGRDLERLIKFPNVDLPDDDTDEQTSELARLFDEVRQKTKIDFSSYKL
STVLRRLQRRFLATETENLSAYLGYIEQNPNELDSLAKETLISVTEFFRDKESQKTLERY
IKELIARKKPNEEIRVWVVGCATGEEAYSLAILFSEHIRSQDSRARLQVFATDIDNDALS
FARRGFFNSAAMAEVPQEYLNRYFRPSGNGFEPIKELRDCIVFARQDIVSDPPFLKVDLI
SCRNVLIYFNADLQAKVLNVLHFALKTDGLLFLGKSESVSQKDTLFAVLDRRARIFQSRG
GGSALDIKMSRRGRLPLTLPPKKQDHTHERQFFEAVRKFYAPYAMLIDSAFNIVYLQGSI
NKFIDFPSGRPDMNLAQIIVPEFRNELLTTLHRARRHQASVYSRKRRIASLDFQTWRLAV
HPLEDYRDEIYLLAFEETGKSSGNKSDSVNLLASANEAGDDDELQSVREHLQTLLEEMAS
SNEEMQALNEEVQASNEELQATNEELEAANEELQATNEELISVNEESLVKSAELAALNSE
FESLYNTMDFPILVFDCHLILKRSNLSAMRQLDISMSGNNRHVSRIDFPPYLVDIEKRLL
NAADKQRKENYTVYLNDRSYQVYITPTINTTGVTQSIVLFIIDNTELVAANRLIKETQDK
LLSIMNHSPYLVSLKDTAGRYEFVNYRFCELFGVSGESILGKTDRQLFSQDIADPLRRRD
LEAMEHQSLVQAKQEFKIGSRSVFLESTHFSIFDQSGVARSICMQAIDVTQKQKAEEQLR
LAVKVFDRAGEAIMITDASGRIIKVNDAFTTITGYQPGDVIGRKPSILQSGLHDDAFYQA
MWNSIKGNGGWQGEINNRRADGTVYPEWLTISAVHDVSGELVNYVGIFSDISAMKASQNR
IEHLATHDELTGLPNRTLLMDRLRHNLFQAKRKKESLAVLFIDLDNFKNINDALGHEAGD
VLLKQATDRLLACMRDADTLARLGGDEFVAILYNIDGADINRIAIRVVDSLSASFRIYDR
DCFVSCSMGISIYPQDGEDSTTLLKNADTAMYRAKDQGRNQFQYFADEMKLKALQRLTIE
TGLRLAMDHQRLFLHYQPKIDLPSGLIVGAEALLRWHDPNLGNVSPAQFIPVAESCGLIN
KLGEQVMTMVAADIHFWKQKGVEVPPIAINLSVHQLRDKRFGDILISRLSEFDVPAQAIT
LEITESMLMERIEETERLLADLSAQGFKISVDDFGTGYSSLLYLKKLPIDELKVDRSFVD
GIDEQSEDRSITDAIINMAHALHLKVVAEGVETEAQLRVLRSLDCDVVQGYYYYRPLSAN
QFYAVLAQ
NT seq 4527 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggctcatccgtactttgctgtccagaatcagagattagttccgctcaatcccat
atcgttggtattggtgcttccgcaggtggtctcgaggcgttgtcggcgtttgtcggtaat
atacccgaggggcttgggtgcgtgtatatcattgcgcaacacatgtcgccgaatcatcgc
agcatgatggtcgatatattatcgagagagtccacactgcccgttcaaacagtggtagac
ggcggtttacctgagcccgaaaatatctatgtcgtccctcccggtttcaatctgtcgatt
cgagaaggcgtatttcgattgcagccgccgttgccggaaatttcgccgaagccttcggtt
aatttattgtttcaatcgatggccgaatattacgacgaacgcgcggtcggcattatttta
tccggaaccgggtcagacggaacgagcggtttgagagcagtcaaggcggccggcggcatc
accttcgcacaactgccggagtcggccaagtacgacggcatgcctcgctcggcgatcgaa
tctggcgtggtcgaccgtatcatgatgcccgatcagatgggccgggatttggaacgcttg
attaaatttccgaacgtcgatttaccggatgacgatacggatgaacagacttcggaattg
gcgcgtcttttcgacgaggtgcggcaaaaaaccaagatcgatttttcgagttacaaattg
tcgacggttctgcggcgattacaacgacgttttttagcgaccgaaactgaaaacctgagc
gcttatttgggttatatcgagcagaatccgaacgagctggatagtctggcgaaagaaacg
ttgatttcggtgaccgaattttttcgcgacaaagagtcgcaaaaaaccttggaacgctat
atcaaagaattgatcgcgcgcaaaaagcccaacgaggaaatccgtgtgtgggttgtcggt
tgcgcgaccggagaagaggcttattcgctcgcgattttattcagcgaacatatccgttcg
caagatagtagggcgaggcttcaggttttcgcgaccgatatcgacaacgatgcgctatcg
tttgctcgacgcggattcttcaatagcgcggcgatggctgaagtaccccaagaatatctc
aaccgctattttcgcccctccggtaacggctttgaaccgatcaaggaattgcgcgactgt
atcgtgttcgcgagacaagatattgtcagcgatccgccgtttttaaaagtcgatttgatc
tcgtgtcgcaatgtattgatttatttcaatgccgatttgcaggccaaagttttgaatgtc
ttgcattttgccttgaaaaccgacggtctgctgtttctcggcaaatccgaaagtgtcagt
caaaaggatacgttgtttgccgtgctggatcgtcgcgcgcgtatctttcagagtcgcgga
ggaggcagtgcgctggatattaaaatgagtcggcgcggccgactgccgttgacgctgccg
ccgaaaaaacaagatcatacccatgagcgccaatttttcgaagcggtgcgaaagttttat
gcgccgtatgcgatgttgatcgattcggcgttcaatatcgtttatttgcaaggctcgatc
aataaattcatcgattttccaagcggcagacccgatatgaacctggcgcaaatcatcgta
cccgaatttcgtaacgaactgttgacgaccttgcatcgcgctcgccggcatcaggcgagc
gtgtatagccgtaagcggcgtattgcatcgctcgacttccaaacctggcgtctggccgtg
catccgctcgaggattatcgggacgaaatttatttgcttgcattcgaggaaaccggaaaa
tcgagcggcaataaatccgactcggtgaatttgttggcatcggccaacgaagccggtgac
gacgatgagctgcaatccgtacgcgaacacttgcaaaccttgctcgaagagatggcctct
tcaaacgaggaaatgcaagcacttaatgaggaagtgcaagcatccaacgaagagctgcag
gcgacgaacgaagagttggaggctgcgaatgaagagttgcaagcgaccaatgaagaattg
atcagcgtcaatgaagaaagcttggtcaaatcggccgaattagccgcgctaaacagcgaa
tttgaaagtctttataatacgatggattttccgatcctcgtcttcgattgccacctgatt
ctcaaacgctccaatctgagcgcgatgcggcaactcgatatttcgatgtccggtaacaac
cgtcatgtgtcgcgtatcgactttcctccttacttggtcgatatcgaaaagcgcctgctg
aatgccgccgacaaacagcgcaaagaaaattacacggtctatctaaacgatcgctcgtat
caggtttatatcacgccgacgataaatactacaggcgttacgcaaagcatcgtgttgttc
attatcgacaataccgaactggttgccgcgaatcgtttgatcaaggaaacgcaagacaaa
ctgctgtcgattatgaatcactcgccttacttggtgtctttgaaagatacggcgggacga
tacgaattcgtcaattatcgcttctgtgaactgttcggcgtcagtggcgagtcgatcttg
ggtaaaaccgatcggcagctattttcgcaggatattgctgatccgttgcgccgccgcgat
ttggaggcgatggaacatcaatcgttggttcaggcgaaacaggaatttaaaatcggctcc
cggtccgtgtttttggagtcgacgcatttttcgatattcgatcaaagcggcgttgcccgt
tcgatttgcatgcaagcgattgacgtgacgcaaaaacaaaaagccgaagagcaattacgc
ctggccgtcaaagtgttcgaccgggctggcgaggcaatcatgattaccgacgcgtccggt
cgcatcatcaaggtcaacgatgcgtttacgacgattaccggctatcagcccggcgacgtg
attggacgcaaaccttcgatcctacaatcgggtttgcatgacgacgcgttttatcaagca
atgtggaatagcatcaagggaaacggcggttggcagggcgaaatcaacaaccggcgagcc
gacggtacggtttaccccgagtggttgacgatcagcgcggtacatgacgtcagcggcgag
ttggtcaattatgtcggcatcttcagcgatatttccgcgatgaaggcttcgcagaatcgc
atcgagcatttggcgacgcatgatgaactgaccggtttgccgaatcggacgctattgatg
gatcggctgaggcataatttatttcaggctaagcgcaagaaagaatcgctcgcggttcta
ttcatcgatttggacaacttcaagaatatcaacgacgcgttggggcatgaagctggcgat
gttttattgaaacaagcgactgaccggttattggcgtgcatgcgcgacgccgatacgctt
gcccgtttgggtggagatgaattcgtcgcgattttgtacaatatcgacggcgccgatatc
aatcgaatcgcgatacgagtcgtcgattcgctttccgcatcgttccgtatttacgatcga
gactgtttcgtttcatgcagtatgggtatcagtatttacccgcaggacggggaggacagt
acgacgttgttgaaaaatgccgataccgcgatgtatcgcgcgaaggatcaaggcagaaat
caatttcaatatttcgccgacgaaatgaagctgaaagctttgcagcgtttgacgatcgaa
accggcttgcggctcgcgatggatcaccaacggctttttttgcattatcaaccgaaaatt
gatttgccgagcggtttgatcgtcggtgccgaagcgttattacggtggcacgatccgaat
ttgggcaacgtatcgccggcgcagtttattccggtcgcggaaagctgcggtttgatcaat
aagctcggtgaacaggtcatgacaatggtggctgccgatattcatttttggaagcaaaaa
ggggtcgaggttccgccgattgcgattaatctgtcggtgcatcagttaagggataaacgt
ttcggcgatatactgatctcacgtttgagtgaattcgacgtcccggcgcaagcgattacg
ttggagattaccgaaagtatgctgatggagcgtattgaagaaaccgagcgtttgttggcg
gatttatcagctcaaggctttaaaattagcgtcgacgatttcggcaccggttattcatct
ctgttatatcttaaaaagctgccgatcgacgaattgaaagtcgaccggagtttcgttgac
gggatcgacgagcagtccgaagatcgctcgattacggatgccattatcaatatggcgcac
gcgttacatttgaaagtcgttgccgagggcgtcgaaactgaagcgcaattacgtgttttg
cgcagcctcgattgcgacgttgttcaaggatactattattaccggccgttatcggcaaac
caattttatgctgtattggcacaatag

DBGET integrated database retrieval system