KEGG   Methylomicrobium alcaliphilum: MEALZ_1035Help
Entry
MEALZ_1035        CDS       T01649                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mah03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185500..1186105
Genome map
AA seq 201 aa AA seqDB search
MIGYLRGKLASKAPPVLVIDVNGVGYEVEAPMTTFYNLPKLGEEVKLFTHLVVREDAHIL
FGFASESDRLMFRTLIKVNGVGPKLALTILSGQSAEEFHRCIHNNDTQSLVRLPGVGKKT
AERLIVEMRDRLPELGGSSASAESGETILPAIAAQPIQEAISALCALGYKPQDAGRMVRA
IPAEGKSCEDIIRLALQGAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggttatttgcgggggaagctggcgagtaaggctccgccggtattggtgatcgat
gtcaatggcgtcggctatgaagtcgaagcgccgatgacgacgttttacaacttgcccaaa
ctcggtgaagaggtcaagttgttcacgcatctagttgtaagggaagacgcgcatatccta
ttcggttttgcgtccgaatccgatcgtttgatgttcagaaccttgatcaaagtcaatggt
gtcgggcctaaattagctttgacgatcttgtcgggccaaagcgccgaagagtttcatcgt
tgtattcacaataacgatactcagtctttagtgcgcttgcccggagtcggtaaaaagact
gccgagcgcttaatcgtcgaaatgcgcgaccgcttacctgaattgggcggttcgtcggct
tcggccgaaagtggcgagacgatattaccggcgattgccgcgcagccgattcaggaggcg
attagcgcgttatgcgcgttgggttacaaaccgcaagatgcggggcgaatggttcgcgcg
attcctgccgaaggcaaaagttgtgaggacatcatcagattagctctgcaaggggcagcg
aaatga

DBGET integrated database retrieval system