KEGG   Methylomicrobium alcaliphilum: MEALZ_1035Help
Entry
MEALZ_1035        CDS       T01649                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mah00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MEALZ_1035 (ruvA)
Enzymes [BR:mah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MEALZ_1035 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185500..1186105
Genome map
AA seq 201 aa AA seqDB search
MIGYLRGKLASKAPPVLVIDVNGVGYEVEAPMTTFYNLPKLGEEVKLFTHLVVREDAHIL
FGFASESDRLMFRTLIKVNGVGPKLALTILSGQSAEEFHRCIHNNDTQSLVRLPGVGKKT
AERLIVEMRDRLPELGGSSASAESGETILPAIAAQPIQEAISALCALGYKPQDAGRMVRA
IPAEGKSCEDIIRLALQGAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggttatttgcgggggaagctggcgagtaaggctccgccggtattggtgatcgat
gtcaatggcgtcggctatgaagtcgaagcgccgatgacgacgttttacaacttgcccaaa
ctcggtgaagaggtcaagttgttcacgcatctagttgtaagggaagacgcgcatatccta
ttcggttttgcgtccgaatccgatcgtttgatgttcagaaccttgatcaaagtcaatggt
gtcgggcctaaattagctttgacgatcttgtcgggccaaagcgccgaagagtttcatcgt
tgtattcacaataacgatactcagtctttagtgcgcttgcccggagtcggtaaaaagact
gccgagcgcttaatcgtcgaaatgcgcgaccgcttacctgaattgggcggttcgtcggct
tcggccgaaagtggcgagacgatattaccggcgattgccgcgcagccgattcaggaggcg
attagcgcgttatgcgcgttgggttacaaaccgcaagatgcggggcgaatggttcgcgcg
attcctgccgaaggcaaaagttgtgaggacatcatcagattagctctgcaaggggcagcg
aaatga

DBGET integrated database retrieval system