KEGG   Methylomicrobium alcaliphilum: MEALZ_1358Help
Entry
MEALZ_1358        CDS       T01649                                 

Gene name
pdhB
Definition
pyruvate dehydrogenase E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEALZ_1358 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_1358 (pdhB)
   00020 Citrate cycle (TCA cycle)
    MEALZ_1358 (pdhB)
   00620 Pyruvate metabolism
    MEALZ_1358 (pdhB)
Enzymes [BR:mah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MEALZ_1358 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524026..1525339)
Genome map
AA seq 437 aa AA seqDB search
MSELIEIKVPDLGGSSEVDVVEILVQPGDTIEIEQPLVVLETDKATMDMPSTIAGTIREL
KIKVGDKVSQGVTIATVEASEPSEPEQKPPVSEPEPATEATDKQDKPIEEKPAESAASAP
AASPAPTPAATIDTELSGQHLPHATPAIRLFARELGVDLSLIRQGSGRKGRILKEDVKAY
VKQTLSEGVKSSGAGIPPIPAVDFTQFGETEVLPLSKIKRLTGQNMTRVWLNLPLVTHHD
EADITELEAFRKQINAENSQNGKVTGLIFIIKALANALKQFPNFNASLSPDGESLILKKY
CHIGIAVDTPNGLVVPVLRDVDRKSIYELSAELATLSEKARAGKLMPNEMQGGSMTISSL
GGIGGTAFTPIVNAPEVAILGVTRAKMQPVWDGKEFQPRLMLPLDMTYDHRVIDGAEAAR
FMVKLTDFLTDIRRLIL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattgattgagattaaagtacccgacctcggcggctccagcgaagtcgacgtg
gtcgaaattcttgttcaacccggcgatacgatagaaatcgaacagcctttagtcgtcttg
gaaaccgacaaagctacaatggatatgccatcgacgattgccggcacgattcgggaactc
aaaatcaaagtcggcgacaaagtatcccaaggggttaccatcgctaccgtcgaagctagc
gaaccctccgaacctgaacagaagcctccggtttcagaaccggaaccggcaactgaagcc
acagacaagcaagacaagccgatcgaggaaaaaccggctgaaagtgccgcttcggcacca
gccgcctctcctgctccgacgccggccgccacgatcgataccgaacttagcggccaacac
cttccgcatgcaacgccggctattcgattattcgcccgtgaattgggcgtcgacctaagt
cttattagacaaggcagcggccgaaagggacgaattctaaaagaagacgtcaaagcctat
gtcaagcaaacactcagcgaaggcgtcaaatcttccggagcgggcatcccgccgatacct
gccgtggacttcacgcaattcggcgaaaccgaagtcttgccattgagtaaaatcaaacgc
ctaaccggacaaaacatgacccgggtgtggctgaacctaccattggtgacccatcatgac
gaagccgatatcacagaattggaagcctttcgcaaacaaatcaatgccgaaaacagtcaa
aacggtaaggtcacaggcttgatcttcatcatcaaagcattggcaaatgcgctgaaacag
tttccgaattttaatgcctcgttatcgccggacggcgagagcctgatcctgaaaaaatac
tgccacatcggcatcgccgtcgacacgcctaacggccttgtcgtacctgtactgcgagac
gtcgaccgaaaaagcatttatgaattatcggcggaactggcaacattgagcgaaaaagcc
cgcgccggcaaactaatgccgaacgaaatgcaaggcggctcaatgacgatctccagtctc
ggcggcattggcggcaccgcattcacaccgatcgttaacgcgccggaagtcgcgatactc
ggtgtcacgcgagccaaaatgcagccggtatgggacggcaaggaattccaaccgcgtttg
atgttaccgctagacatgacctatgaccatcgagtcatcgatggtgccgaagcggcgcgt
tttatggtcaaattaacagattttttgaccgatatcagacggttgatactttaa

DBGET integrated database retrieval system