KEGG   Methylomicrobium alcaliphilum: MEALZ_1396Help
Entry
MEALZ_1396        CDS       T01649                                 

Definition
di-heme enzyme; cytochrome c peroxidase/MauG domain
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mah  Methylomicrobium alcaliphilum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571754..1573061)
Genome map
AA seq 435 aa AA seqDB search
MKKIIKIGLLGAIFAPTTYANQNALTDMDFHNSSSEKIKLGQFLFYDKILSGNLNISCAS
CHHPMAGTGDGLALPVGEGGKGLGVTRDTGSGIDAIHERVPRNAPHLFNLGAKEFVTMFH
DGRLTVNPNHPSGFDSPAGDALPAGLDHSLAAQAMFPVTSTTEMAGQAGENPVGDAATAD
NFTEVWSLLTARVMAIDEYRDLIHQAYPGLADQNVSFVHIANAIGAFEATAFRADNSSFD
RYLRGEIKLSQGERMGHKVFKDNCMSCHSGLLQTDHQFHAIGIPQIGPGKGDGFEGHDDF
GREQVTSDSLDRYRFRTPTLRNVAITGPWGHDGAYDTLEGMIRHHLNPEQSLDNYDINQA
RLPPRADLNQIDRLVYDDWVSREELKASIEIQSVDLSNEEVSYLIDFLNALTDTASLDMR
NTVPYRVPSGLPIAD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatcaaaataggattactcggcgcaatatttgctccgacaacttacgct
aaccaaaatgccctgaccgacatggattttcacaattccagctcggaaaaaatcaaacta
ggacaattcctcttctatgacaaaatattatccggaaacctcaatatttcatgcgcgtct
tgccaccatccaatggctggcacaggtgacggtttggctttgccggtcggcgaaggcggc
aaaggattaggagtcacgcgagataccggcagcgggatagacgctattcatgagagggta
ccgagaaatgcgcctcatttattcaacctaggcgcaaaagaattcgtcactatgtttcat
gacgggcgtttaacggttaaccctaatcacccctctggcttcgactccccggccggtgac
gctttacctgcaggcttggatcattctcttgcagctcaagccatgtttccagtaacttca
actactgagatggctgggcaagccggagaaaaccccgtgggcgatgccgcaactgcagat
aactttacggaagtatggagtctgttgacagctcgggtgatggcaatcgacgaatatcgc
gatttaattcaccaagcctatcctggcctcgccgatcagaatgtaagctttgtccatatc
gccaatgctatcggtgctttcgaagcgactgcatttcgtgctgataacagctctttcgat
cgttatctgagaggtgaaatcaaattgagccaaggtgaaagaatgggccacaaagttttc
aaagacaactgcatgtcttgtcatagcggcctactacaaacggatcaccagttccatgcc
ataggcataccgcaaatcggcccaggtaaaggcgatggctttgaggggcatgacgacttc
gggcgcgaacaggttaccagcgacagcttagatcgctatcgcttccggactccgactctt
cgcaatgtcgcgatcacgggaccttggggacatgatggcgcctacgacacattggaaggc
atgattaggcatcacctaaaccctgaacaaagcctggataactacgatataaaccaggcc
cgtttaccgcctcgcgccgatttgaatcagattgaccgactcgtttacgacgattgggtg
agccgcgaagaacttaaagcgagcattgaaatccagtcagtagacttatcaaacgaagaa
gtcagttatctaattgatttcctaaatgcactaaccgatactgctagtttggatatgcgc
aatacagtgccctatcgagtaccgagcggcttaccaatagccgattaa

DBGET integrated database retrieval system