KEGG   Methylomicrobium alcaliphilum: MEALZ_1483Help
Entry
MEALZ_1483        CDS       T01649                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00260  Glycine, serine and threonine metabolism
mah00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01130  Biosynthesis of antibiotics
mah01230  Biosynthesis of amino acids
Module
mah_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEALZ_1483 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEALZ_1483 (trpB)
Enzymes [BR:mah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEALZ_1483 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCE23171
UniProt: G4SXX7
Position
1675279..1676481
Genome map
AA seq 400 aa AA seqDB search
MTQHYNLPDERGHFGPYGGKFVAETLMGPIQELEEAYLRYMQDPEFLTELDADLQHYVGR
PSPLYHAERWSRHLGGAQLYLKREDLNHTGAHKVNNTIGQALLAKRMGKTRIIAETGAGQ
HGVATATVAARLGLECVVYMGAVDVARQSLNVYRMKLLGAKVVAVESGSKTLKDALNEAL
RDWVTNVDNTFYIIGTVAGPHPYPAMVRDFQTVIGREAKEQCLTMTGRLPDALVACVGGG
SNAIGLFYPFIDDASVKMYGVEAAGDGVETGRHSAPLCAGRPGVLHGNRTYLIEDDDGEI
IETHSISAGLDYPGVGPEHAWLKDSGRAEYVNITDDEALKGFHDLTEMEGIIPALESSHA
IAYTTKLAPTMPKDSIIIINLSGRGDKDIMTLAQREGIEL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcattataacttgccggacgagcgcggacatttcggtccttatggcggaaaa
ttcgttgccgaaacattaatggggcctattcaagagttagaagaggcttatctgcgctat
atgcaggatcctgaatttttaaccgaattagatgccgatttgcagcattatgtcggacgc
ccttcaccgctttaccatgccgaacgctggagtcggcatttaggcggagcgcagctttat
ttgaaacgagaagacctcaatcataccggcgcgcataaagttaataatacgatcggacag
gcgttattggctaagcgcatgggaaaaacccggatcatcgctgaaaccggcgcgggtcag
catggcgtggctacagctacggtcgctgcgagactgggactcgagtgcgttgtttatatg
ggggcggtcgatgtcgcgcgacagtccttgaatgtttaccgaatgaaactgcttggcgca
aaagtcgttgcggtcgaatcgggttcgaagactttgaaagacgcgttaaacgaagcgctc
cgtgattgggttaccaatgtcgacaatacattctacattattggaacggtagcagggccg
catccttatcccgcgatggtgcgcgattttcaaaccgtgatcggccgtgaagccaaagaa
caatgcttgaccatgaccgggcggttgcccgatgcgctggtcgcttgtgtcggggggggg
tcgaacgcgatcggtttgttttatccttttatcgacgatgcgtcggtcaaaatgtacggc
gtcgaagcggccggagacggcgtcgaaaccggacgtcattctgctccgctttgcgcggga
cgtccgggagttttgcacggcaatcggacttatttgatcgaggacgatgatggtgaaatc
atcgaaacgcattcaatctcggcgggcttggattatcccggcgtcggacccgagcatgct
tggttgaaagacagcgggcgcgccgaatatgtcaatataaccgatgatgaagccttgaag
gggttccatgatctaaccgaaatggaaggcattatccctgcgctggaatcgagtcatgcg
attgcttatacgacaaagctggcgccgaccatgcccaaagacagcattattattatcaat
ctttccggtcgtggcgataaagatatcatgaccttggcgcaacgcgagggaatagaactg
tga

DBGET integrated database retrieval system