KEGG   Methylomicrobium alcaliphilum: MEALZ_1484Help
Entry
MEALZ_1484        CDS       T01649                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MEALZ_1484 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MEALZ_1484 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MEALZ_1484 (trpA)
Enzymes [BR:mah01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MEALZ_1484 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1676478..1677281
Genome map
AA seq 267 aa AA seqDB search
MSRLAAKFDELSKSGRKALIPFLTAGDPHPNFTVPMMHAMVEAGVDIIELGVPFSDPMAD
GPVIQKASERALAHKMSLRKVLNIVAEFRRKDDQTPVVLMGYLNPIEAMGYEDFANAAQR
VEIDGVLTVDLPPEEADFCVSLLNERGIDPVFLLAPNSNEERIRKMDAAGSGYIYYVSLK
GVTGAGHLNTADVEERLKLIRANTRLPIGIGFGVKDAETAKTVAHLGDGVVVGSALISKI
EANLDNPEQACSEIVDLLKAMRAAMDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtttagccgcaaaattcgatgagctttccaaatcaggccgtaaggctttaatt
ccatttttgacggccggcgatccgcatccgaattttaccgtgccgatgatgcatgcgatg
gtggaagcgggcgttgatattattgagcttggcgtaccgttttccgatccgatggcagac
gggccggttattcagaaagccagtgaacgtgccttggcgcataaaatgagtttaagaaaa
gtactcaatatagtcgccgaattcagaagaaaggatgaccaaacgccggttgtgttgatg
ggctatttaaatccgatcgaggcaatgggttacgaagactttgccaatgcggcgcaacgc
gtagaaatcgatggtgtgctgacggttgatttgccgcctgaggaggccgatttctgtgtt
tcgttgctgaatgaacgcggtatcgatccggtttttttgttggcgcctaatagtaatgaa
gaacgcattcgtaaaatggatgcggcgggcagtggctatatttactacgtttcactcaaa
ggtgtgaccggtgccgggcacttgaataccgccgatgtcgaggaaaggctgaagttaatt
cgtgcgaatactcgattgccgatcggtatcggcttcggtgtcaaggatgccgaaacggca
aagacagtggctcatttaggtgatggtgtcgttgtcggtagcgccttgatcagtaaaatc
gaagcgaatttggataatccggagcaggcctgttccgaaatagtcgatttacttaaagcc
atgcgcgccgcaatggatgaataa

DBGET integrated database retrieval system